|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G12120 | AT | Annotation by Michelle Graham. TAIR10: fatty acid desaturase 2 | chr3:3860592-3861743 REVERSE LENGTH=383 | SoyBase | E_val: 1.00E-33 | ISS |
| GO:0006629 | GO-bp | Annotation by Michelle Graham. GO Biological Process: lipid metabolic process | SoyBase | N/A | ISS |
| GO:0055114 | GO-bp | Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0005783 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum | SoyBase | N/A | ISS |
| GO:0016717 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water | SoyBase | N/A | ISS |
| GO:0016720 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: delta12-fatty acid dehydrogenase activity | SoyBase | N/A | ISS |
| GO:0045485 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: omega-6 fatty acid desaturase activity | SoyBase | N/A | ISS |
| PF00487 | PFAM | Fatty acid desaturase | JGI | ISS | |
| UniRef100_C6TI10 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TI10_SOYBN | SoyBase | E_val: 6.00E-41 | ISS |
| UniRef100_Q5FB99 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Microsomal omega-6 fatty acid desaturase n=1 Tax=Glycine max RepID=Q5FB99_SOYBN | SoyBase | E_val: 3.00E-40 | ISS |
|
Glyma09g14365 not represented in the dataset |
Glyma09g14365 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma09g14365.1 sequence type=CDS gene model=Glyma09g14365 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTCTGCCTTCTGCCTCTATTATGTTGCCACCCATTACTTCCACGTCCTTCCCAGCCCTTTCTCTTTCTTGGCATGGCCAATCTACTGGGCTGTCCAAGGTTGCATCCTTACTGGAGTTTGGGTCATTGCCCATGAGTGTGGCCACCATGCATTCAGTGACTACCAGTTGCTTGATGATATTGTTGGCCTTGTCCTCCACTCCGGTCTCCTAGTCCCATGCTTGGACCTGTGA
>Glyma09g14365.1 sequence type=predicted peptide gene model=Glyma09g14365 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MSAFCLYYVATHYFHVLPSPFSFLAWPIYWAVQGCILTGVWVIAHECGHHAFSDYQLLDDIVGLVLHSGLLVPCLDL*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||