SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g13521): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g13521): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g13521

Feature Type:gene_model
Chromosome:Gm09
Start:14980322
stop:14983843
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g13521
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G34890AT Annotation by Michelle Graham. TAIR10: xanthine dehydrogenase 1 | chr4:16618736-16624983 REVERSE LENGTH=1361 SoyBaseE_val: 3.00E-20ISS
GO:0000302GO-bp Annotation by Michelle Graham. GO Biological Process: response to reactive oxygen species SoyBaseN/AISS
GO:0006145GO-bp Annotation by Michelle Graham. GO Biological Process: purine nucleobase catabolic process SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0042554GO-bp Annotation by Michelle Graham. GO Biological Process: superoxide anion generation SoyBaseN/AISS
GO:0046110GO-bp Annotation by Michelle Graham. GO Biological Process: xanthine metabolic process SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004854GO-mf Annotation by Michelle Graham. GO Molecular Function: xanthine dehydrogenase activity SoyBaseN/AISS
GO:0005506GO-mf Annotation by Michelle Graham. GO Molecular Function: iron ion binding SoyBaseN/AISS
GO:0008762GO-mf Annotation by Michelle Graham. GO Molecular Function: UDP-N-acetylmuramate dehydrogenase activity SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
GO:0016614GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on CH-OH group of donors SoyBaseN/AISS
GO:0046872GO-mf Annotation by Michelle Graham. GO Molecular Function: metal ion binding SoyBaseN/AISS
GO:0050660GO-mf Annotation by Michelle Graham. GO Molecular Function: flavin adenine dinucleotide binding SoyBaseN/AISS
GO:0051536GO-mf Annotation by Michelle Graham. GO Molecular Function: iron-sulfur cluster binding SoyBaseN/AISS
GO:0051537GO-mf Annotation by Michelle Graham. GO Molecular Function: 2 iron, 2 sulfur cluster binding SoyBaseN/AISS
PTHR11908Panther XANTHINE DEHYDROGENASE JGI ISS
PTHR11908:SF8Panther UNCHARACTERIZED JGI ISS
PF02738PFAM Molybdopterin-binding domain of aldehyde dehydrogenase JGI ISS
UniRef100_D7M437UniRef Annotation by Michelle Graham. Most informative UniRef hit: ATXDH1 n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7M437_ARALL SoyBaseE_val: 5.00E-18ISS
UniRef100_UPI0002338177UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002338177 related cluster n=1 Tax=unknown RepID=UPI0002338177 SoyBaseE_val: 2.00E-45ISS

Expression Patterns of Glyma09g13521
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g13521 not represented in the dataset
Glyma09g13521 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g13521 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g097400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma09g13521
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g13521
>Glyma09g13521.1   sequence type=CDS   gene model=Glyma09g13521   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTTGCACAAAATTACTTGCAGGTGCTCTGGTTCAAGTCTATACAGATGGAACTATTTTAGTTACCCATGGGGGTGTCGAAATGGGGCAAGGTTTGCATACCAAAGTTGCCCAAATTGCTGCTTCAGCTTTTCATATCCCTCTTTGTTCAATGAAAGAAGTTCTAATCAATCTATTTAAAGTGTTCATACCCAATCAAGATCACACAAGTAGTCCAATTAAAACTTATATGGGATAG
Predicted protein sequences of Glyma09g13521
>Glyma09g13521.1   sequence type=predicted peptide   gene model=Glyma09g13521   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVCTKLLAGALVQVYTDGTILVTHGGVEMGQGLHTKVAQIAASAFHIPLCSMKEVLINLFKVFIPNQDHTSSPIKTYMG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo