SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g12900

Feature Type:gene_model
Chromosome:Gm09
Start:13998408
stop:13999594
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g12900
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G28050AT Annotation by Michelle Graham. TAIR10: Cytidine/deoxycytidylate deaminase family protein | chr5:10044209-10045755 REVERSE LENGTH=185 SoyBaseE_val: 7.00E-26ISS
GO:0009061GO-bp Annotation by Michelle Graham. GO Biological Process: anaerobic respiration SoyBaseN/AISS
GO:0009218GO-bp Annotation by Michelle Graham. GO Biological Process: pyrimidine ribonucleotide metabolic process SoyBaseN/AISS
GO:0019690GO-bp Annotation by Michelle Graham. GO Biological Process: pyrimidine deoxyribonucleoside interconversion SoyBaseN/AISS
GO:0019692GO-bp Annotation by Michelle Graham. GO Biological Process: deoxyribose phosphate metabolic process SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0016787GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity SoyBaseN/AISS
UniRef100_G7IQF5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cytidine deaminase n=1 Tax=Medicago truncatula RepID=G7IQF5_MEDTR SoyBaseE_val: 2.00E-26ISS
UniRef100_I1L2B5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L2B5_SOYBN SoyBaseE_val: 1.00E-110ISS

Expression Patterns of Glyma09g12900
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g12900 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma09g12900
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g12900
>Glyma09g12900.1   sequence type=CDS   gene model=Glyma09g12900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTGGAAAATCTAGAACTCCAACAGAAGCAACAGCTAGAACAACACCAATTTGTTCAAACACATCAAAGAGATACCATATCACAAAGTGAAGAAGAGCAGCAACAAGGCTTCTCTGAAAAGCATTCTGGATCTTCTGAATGTGAAGAAAACAGCAGATTGCCCTCTCCTGGTGGAAGCTGGACCACTGCTTCAGACACTTTTCTTAGCAGGAAATGTTTAGTAGTCCCATTTATGTTTGGTGGTGCCAAATGGTTTTTGCTTGTGTTTTTTCACACTAGGTTGGTTTATGGAGCAAAGGCAGAGGCAGCAATTGCTATTAGGTTCGATGACTTCATTTCAGATGCATTGCGAGGTACTGCATTCTATCAGAAGGCACAATTGCAGATTAAAAGGGATGATGGCAAAGAAGCTAACATTGCTGAAGAAGTTTTTGAGAGAACAGAGGAAAAATTCCGAATGTATTAA
Predicted protein sequences of Glyma09g12900
>Glyma09g12900.1   sequence type=predicted peptide   gene model=Glyma09g12900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLENLELQQKQQLEQHQFVQTHQRDTISQSEEEQQQGFSEKHSGSSECEENSRLPSPGGSWTTASDTFLSRKCLVVPFMFGGAKWFLLVFFHTRLVYGAKAEAAIAIRFDDFISDALRGTAFYQKAQLQIKRDDGKEANIAEEVFERTEEKFRMY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo