SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g12580

Feature Type:gene_model
Chromosome:Gm09
Start:13618309
stop:13619474
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g12580
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G35100AT Annotation by Michelle Graham. TAIR10: Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein | chr5:13360459-13361377 REVERSE LENGTH=245 SoyBaseE_val: 2.00E-24ISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0018119GO-bp Annotation by Michelle Graham. GO Biological Process: peptidyl-cysteine S-nitrosylation SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0031977GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid lumen SoyBaseN/AISS
GO:0003755GO-mf Annotation by Michelle Graham. GO Molecular Function: peptidyl-prolyl cis-trans isomerase activity SoyBaseN/AISS
UniRef100_B9SC31UniRef Annotation by Michelle Graham. Most informative UniRef hit: Peptidyl-prolyl cis-trans isomerase, putative n=1 Tax=Ricinus communis RepID=B9SC31_RICCO SoyBaseE_val: 6.00E-22ISS
UniRef100_UPI000233D4D8UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233D4D8 related cluster n=1 Tax=unknown RepID=UPI000233D4D8 SoyBaseE_val: 1.00E-28ISS

Expression Patterns of Glyma09g12580
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g12580 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g095500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma09g12580
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g12580
>Glyma09g12580.1   sequence type=CDS   gene model=Glyma09g12580   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCATGTCTCCATTCTTGCATTCGCCTTTGTCACCATTAACGATTCTACACTCCAAGATCAGAGTTCTGATACTAAATTATGGTTGCATTGTGGGGGAATTGAACCTGCATTCATGGGAAAGATGAGAGTTAACTTGGGATCTTTGATCGCTTGTGTCAACCTACATGGACACATTCACATTTGCTATCAACTAGTAAAGTTTGCTACACAAAACCTTTGGGAACGAATTCGCCAGTTTAATGACTTGGCTCAATTTTTTGGAGATGAAAGGGCTCAGAATGCACGTAACATATGGAACAGGCCTCTTAAGAGCGTTTATATTAGTGATTGTGGGGAGCTGAAAGTGACAAAGCCTTCCCTCACGCCTTCTTTGCCATAA
Predicted protein sequences of Glyma09g12580
>Glyma09g12580.1   sequence type=predicted peptide   gene model=Glyma09g12580   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHVSILAFAFVTINDSTLQDQSSDTKLWLHCGGIEPAFMGKMRVNLGSLIACVNLHGHIHICYQLVKFATQNLWERIRQFNDLAQFFGDERAQNARNIWNRPLKSVYISDCGELKVTKPSLTPSLP*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo