SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g12570

Feature Type:gene_model
Chromosome:Gm09
Start:13530957
stop:13532124
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g12570
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G46490AT Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G35110.1); Has 34 Blast hits to 34 proteins in 7 species: Archae - 0; Bacteria - 0; Metazoa - 1; Fungi - 0; Plants - 33; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr2:19079457-19079861 FORWARD LENGTH=134 SoyBaseE_val: 3.00E-23ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0048193GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1L2B0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L2B0_SOYBN SoyBaseE_val: 2.00E-81ISS
UniRef100_Q9FYR1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Gb|AAD20160.1 n=1 Tax=Arabidopsis thaliana RepID=Q9FYR1_ARATH SoyBaseE_val: 3.00E-19ISS

Expression Patterns of Glyma09g12570
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g12570 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g094900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma09g12570
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g12570
>Glyma09g12570.1   sequence type=CDS   gene model=Glyma09g12570   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCTCCGCCGCAGCCGCAGACGGACTCTTCCGGCCGATCTACGAGGGCTGCATCTCCGCCTACGACAACGACGTGGAGCGCCGCCCCTACCACAAGAACTGCGGCTGCGCTCTGCACAGCAAGTCGAGGAGGAACAGCAGCAGAGCGTGCAGGCACAAGTTGCCAAAATGCAACAACGTGTCCTACCCTATGAGGAGGGCTTGGAGTGAAGGGAATTTGTCAATGGTTTCATCAACAACTTCCACGCATTCCTCGCCTTCTTCTTCTCCCGCCGCTGGGTTCAGGCCTCAACACGACGAAGAGGGAAATACTAAAAACAAATTAGTAGTTTTATTTGAGATGAATAATTAA
Predicted protein sequences of Glyma09g12570
>Glyma09g12570.1   sequence type=predicted peptide   gene model=Glyma09g12570   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASAAAADGLFRPIYEGCISAYDNDVERRPYHKNCGCALHSKSRRNSSRACRHKLPKCNNVSYPMRRAWSEGNLSMVSSTTSTHSSPSSSPAAGFRPQHDEEGNTKNKLVVLFEMNN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo