| 
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code | 
|---|---|---|---|---|---|
| AT4G31985 | AT | Annotation by Michelle Graham. TAIR10: Ribosomal protein L39 family protein | chr4:15469931-15470366 FORWARD LENGTH=51 | SoyBase | E_val: 9.00E-28 | ISS | 
| GO:0006412 | GO-bp | Annotation by Michelle Graham. GO Biological Process: translation | SoyBase | N/A | ISS | 
| GO:0005622 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: intracellular | SoyBase | N/A | ISS | 
| GO:0005840 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: ribosome | SoyBase | N/A | ISS | 
| GO:0022625 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit | SoyBase | N/A | ISS | 
| GO:0003735 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome | SoyBase | N/A | ISS | 
| KOG0002 | KOG | 60s ribosomal protein L39 | JGI | ISS | |
| PTHR19970 | Panther | RIBOSOMAL PROTEIN L39E | JGI | ISS | |
| PF00832 | PFAM | Ribosomal L39 protein | JGI | ISS | |
| UniRef100_Q6KAJ8 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L39-1 n=10 Tax=Magnoliophyta RepID=RL391_ORYSJ | SoyBase | E_val: 4.00E-28 | ISS | 
| UniRef100_Q6KAJ8 | UniRef | Annotation by Michelle Graham. Best UniRef hit: 60S ribosomal protein L39-1 n=10 Tax=Magnoliophyta RepID=RL391_ORYSJ | SoyBase | E_val: 4.00E-28 | ISS | 
| 
			 Glyma09g12500 not represented in the dataset  | 
			 Glyma09g12500 not represented in the dataset  | 
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection  | 
			Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome  | 
| Corresponding Name | Annotation Version | Evidence | Comments | 
|---|---|---|---|
| Glyma.09g094800 | Wm82.a2.v1 | IGC | As supplied by JGI | 
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183  | 
    
>Glyma09g12500.2 sequence type=CDS gene model=Glyma09g12500 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGCCTTCCCACAAGACGTTCAGAATCAAGAAGAAGCTCGCGAAGAAGATGAGGCAGAACAGACCCATCCCTTATTGGATCCGCATGAGAACCGACAACACTATCAGGTACAATGCTAAGCGCAGGCACTGGCGCCGCACCAAGCTCGGATTTTAA
>Glyma09g12500.2 sequence type=predicted peptide gene model=Glyma09g12500 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MPSHKTFRIKKKLAKKMRQNRPIPYWIRMRTDNTIRYNAKRRHWRRTKLGF*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||