Report for Sequence Feature Glyma09g12420
Feature Type: gene_model
Chromosome: Gm09
Start: 13185218
stop: 13187950
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma09g12420
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G23740 AT
Annotation by Michelle Graham. TAIR10: ribosomal protein S11-beta | chr5:8008251-8009330 REVERSE LENGTH=159
SoyBase E_val: 9.00E-94 ISS
GO:0006412 GO-bp
Annotation by Michelle Graham. GO Biological Process: translation
SoyBase N/A ISS
GO:0005622 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: intracellular
SoyBase N/A ISS
GO:0005737 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm
SoyBase N/A ISS
GO:0005840 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: ribosome
SoyBase N/A ISS
GO:0016020 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: membrane
SoyBase N/A ISS
GO:0022627 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytosolic small ribosomal subunit
SoyBase N/A ISS
GO:0003735 GO-mf
Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome
SoyBase N/A ISS
KOG1728
KOG
40S ribosomal protein S11
JGI ISS
PTHR10744 Panther
40S RIBOSOMAL PROTEIN S11 FAMILY MEMBER
JGI ISS
PF00366 PFAM
Ribosomal protein S17
JGI ISS
UniRef100_C6T065 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T065_SOYBN
SoyBase E_val: 3.00E-112 ISS
UniRef100_D7MBM0 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: 40S ribosomal protein S11 n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7MBM0_ARALL
SoyBase E_val: 3.00E-101 ISS
Expression Patterns of Glyma09g12420
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma09g12420 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.09g094200 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma09g12420
Coding sequences of Glyma09g12420
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma09g12420.1 sequence type=CDS gene model=Glyma09g12420 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCAGAACAAACAGAGAAGGCTTTTCTGAAGCAACCAAAAGTGTTTCTATGCTCTAAGAAAGGTGGGAAGGGAAAGAGGCCTGGGAAAGGTGGGAATCGCTTTTGGAAGTCAATTGGGCTTGGATTCAAGACTCCCAGAGATGCCATTGAAGGAACATATATTGACAAGAAGTGCCCCTTCACTGGCAATGTTTCCATTCGGGGTCGTATCCTAGCCGGTACTTGTCACAGTGCTAAGATGACAAGGACCATTATTGTAAGGAGGAATTATCTTCATTTTATTAAGAAATACCAGAGATATGAAAAGCGACATTCCAATATTCCTGCACATACATCACCTTGTTTCCGTGTTAAAGAAGGAGATCATGTTATTATTGGCCAATGCAGGCCAATCTCGAAGACAGTGAGGTTCAATGTTTTAAAAGTGATTCCAGCTGGATCCTCTAGCGGAGCAAAGAAGGCATTTACTGGAATGTGA
Predicted protein sequences of Glyma09g12420
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma09g12420.1 sequence type=predicted peptide gene model=Glyma09g12420 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MAEQTEKAFLKQPKVFLCSKKGGKGKRPGKGGNRFWKSIGLGFKTPRDAIEGTYIDKKCPFTGNVSIRGRILAGTCHSAKMTRTIIVRRNYLHFIKKYQRYEKRHSNIPAHTSPCFRVKEGDHVIIGQCRPISKTVRFNVLKVIPAGSSSGAKKAFTGM*