Glyma09g12252 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g12252

Feature Type:	gene_model
Chromosome:	Gm09
Start:	12860541
stop:	12862019
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g12252

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G22142	AT	Annotation by Michelle Graham. TAIR10: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein \| chr3:7803604-7808046 REVERSE LENGTH=1480	SoyBase	E_val: 9.00E-45	ISS
PF02095	PFAM	Extensin-like protein repeat	JGI		ISS
UniRef100_P13993	UniRef	Annotation by Michelle Graham. Best UniRef hit: Repetitive proline-rich cell wall protein 2 n=2 Tax=Glycine max RepID=PRP2_SOYBN	SoyBase	E_val: 1.00E-90	ISS
UniRef100_P13993	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Repetitive proline-rich cell wall protein 2 n=2 Tax=Glycine max RepID=PRP2_SOYBN	SoyBase	E_val: 1.00E-90	ISS

Expression Patterns of Glyma09g12252

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g12252 not represented in the dataset	Glyma09g12252 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma09g12252

Paralog	Evidence	Comments
Glyma15g23830	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma09g12252 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma09g12252

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g12252

Limit To All Plant Sequences

>Glyma09g12252.1   sequence type=CDS   gene model=Glyma09g12252   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCCTTAAGCTCCTTAGTGCTGCTCCTTGCAGCTCTAATTCTATCCCCTCAAGTTCTTGCAAACTATGAGAATCCCCCAGTGTACAAGCCTCCCACTGAGAAACCACCAGTTTATAAGCCCCCAGTTGAGAAGCCTCCTGTTTACAAACCTCCAGTTGAAAACCCCCCAATTTATAAGCCTCCAGTAGAGAAGCCACCAGTGTACAAGCCCCCAGTTGAGAAACCCCCAGTGTACAAGCCCCCAGTTGAAAAACCACCAGTGTACAAGCCCCCAGTTGAGAAACCACCAGTGTACAAGCCCCCAGTTGAAAAACCCCCAGTTTACAAGCCCCCAGTTGAAAAACCCCCAGTGTACAAGCCCCCAGTTGAAAAACCACCAGTGTACAAGCCCCCAGTTGAGAAGCCCCCAGTTTACAAGCCCCCAGTTGAGAAGCCACCAGTATACAAGCCACCAGTTGAGAAGCCTCCAGTGTACAAGCCACCAGTAGAGAAGCCTCCAGTTTACAAGCCACCAGTAGAGAAACCTCCAGTTTACAAGCCCCCAGTGGAGAAACCTCCTATTTACAAGCCACCTGTTGAGAAGCCTCCGGTCTACAAGCCACCATATGGAAAGCCACCATACCCAAAGTACCCTCCAACTGATGACACCCATTTCTGA

Predicted protein sequences of Glyma09g12252

Limit To All Plant Sequences

>Glyma09g12252.1   sequence type=predicted peptide   gene model=Glyma09g12252   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASLSSLVLLLAALILSPQVLANYENPPVYKPPTEKPPVYKPPVEKPPVYKPPVENPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPYGKPPYPKYPPTDDTHF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain