|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G50060 | AT | Annotation by Michelle Graham. TAIR10: myb domain protein 77 | chr3:18558146-18559051 REVERSE LENGTH=301 | SoyBase | E_val: 1.00E-46 | ISS |
| GO:0006355 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent | SoyBase | N/A | ISS |
| GO:0009723 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus | SoyBase | N/A | ISS |
| GO:0009751 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to salicylic acid stimulus | SoyBase | N/A | ISS |
| GO:0010200 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to chitin | SoyBase | N/A | ISS |
| GO:0048527 | GO-bp | Annotation by Michelle Graham. GO Biological Process: lateral root development | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0003677 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: DNA binding | SoyBase | N/A | ISS |
| GO:0003700 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity | SoyBase | N/A | ISS |
| GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS |
| PTHR10641 | Panther | MYB-RELATED | JGI | ISS | |
| PF00249 | PFAM | Myb-like DNA-binding domain | JGI | ISS | |
| UniRef100_Q0PJI9 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: MYB transcription factor MYB124 n=1 Tax=Glycine max RepID=Q0PJI9_SOYBN | SoyBase | E_val: 6.00E-63 | ISS |
| UniRef100_UPI000233D4D2 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233D4D2 related cluster n=1 Tax=unknown RepID=UPI000233D4D2 | SoyBase | E_val: 4.00E-100 | ISS |
|
Glyma09g12164 not represented in the dataset |
Glyma09g12164 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.09g092500 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma09g12164.1 sequence type=CDS gene model=Glyma09g12164 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGAAGTAACGAACAAAAGCTCTTCCTTCACTTTCTCTTCCTTTGATTGCTGCTCTTCCGAGTCCAACCCCAACAAGCCCAGCAGAATCAAAGGCCCATGGAGCACCGAAGAGGTTCAAATCCTAATCAGACTCGTCGAACGATACGACCCACAAAATTGGTCCCTCATCAGTCGCTACATTAAGGGTAGGTCCAACAAGTTGTGCCTGCTCCGATGGTGCAATCAGCTTAGCCCCCCCATGGAGCATCGCCCCTTCTCGGCCCAAGAAAACGACACCATCATCGTAGCCTATGCCAAGTACGATAACAGGTGGGCCACTATAGCCCGATTGCTACCGGGCCGAACCAATAATGCCATTAAGAACCACTGGAACTCCATTCTCAAGCGTAGAGCCAAAGGTATTCAAAGAACCGATAAGTGGCCATGA
>Glyma09g12164.1 sequence type=predicted peptide gene model=Glyma09g12164 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MEVTNKSSSFTFSSFDCCSSESNPNKPSRIKGPWSTEEVQILIRLVERYDPQNWSLISRYIKGRSNKLCLLRWCNQLSPPMEHRPFSAQENDTIIVAYAKYDNRWATIARLLPGRTNNAIKNHWNSILKRRAKGIQRTDKWP*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||