Glyma09g12083 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g12083): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g12083): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g12083

Feature Type:	gene_model
Chromosome:	Gm09
Start:	12507564
stop:	12509480
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g12083

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G56900	AT	Annotation by Michelle Graham. TAIR10: Transducin/WD40 repeat-like superfamily protein \| chr3:21066330-21069343 FORWARD LENGTH=447	SoyBase	E_val: 6.00E-53	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0009909	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of flower development	SoyBase	N/A	ISS
GO:0016570	GO-bp	Annotation by Michelle Graham. GO Biological Process: histone modification	SoyBase	N/A	ISS
GO:0034968	GO-bp	Annotation by Michelle Graham. GO Biological Process: histone lysine methylation	SoyBase	N/A	ISS
GO:0048449	GO-bp	Annotation by Michelle Graham. GO Biological Process: floral organ formation	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005635	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nuclear envelope	SoyBase	N/A	ISS
GO:0005783	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
PTHR14494	Panther	ALADIN/ADRACALIN/AAAS	JGI		ISS
UniRef100_G7L4S7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Aladin n=1 Tax=Medicago truncatula RepID=G7L4S7_MEDTR	SoyBase	E_val: 2.00E-55	ISS
UniRef100_I3T3V9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Lotus japonicus RepID=I3T3V9_LOTJA	SoyBase	E_val: 9.00E-60	ISS

Expression Patterns of Glyma09g12083

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g12083 not represented in the dataset	Glyma09g12083 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g12083 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.09g092000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma09g12083

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g12083

Limit To All Plant Sequences

>Glyma09g12083.1   sequence type=CDS   gene model=Glyma09g12083   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACCTTCGCATGTGTGAAACCCTCTTTGACCAACTCAACTCCACCTTCCGCCGATTTTTCTTCGCTCTGCCTCAGCACCACCTTGATCGTCACACTCAGTCTCTTCATCGATGCACATTTGTTACTTGTTGATCTGCCAGAAATATTATCATTGACAGGCAGTCAGGGAATTGAAAAGATAACATGGGATAATTCCGGGGAGCGATTGGTTGTGTCTTTTAAAGGTGGAGATGATATGTATAAGGGTCTGATCGTCATATATGATACAAGAAGGACTCCTCTTATATCTAGATCATTAATTGGATTTATAAAAGGGCATGGTGACAATCCAAAGCCAATCTCATTTTCATTTCACAAGAAGTTTAAGCAGGGACCATTGCTTTTCGTGAGCAATGGGTTGTGTTGCACGTACCCCTTCTTGTTTCGCTCTCATATGCTTTTCCATAACAAGGATTTTTGTGAAATTTTGTTGGTTGTATACGATTTTGAGCAAGTGGACTTTGACGCTAATGTCTTTTATTGA

Predicted protein sequences of Glyma09g12083

Limit To All Plant Sequences

>Glyma09g12083.1   sequence type=predicted peptide   gene model=Glyma09g12083   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTFACVKPSLTNSTPPSADFSSLCLSTTLIVTLSLFIDAHLLLVDLPEILSLTGSQGIEKITWDNSGERLVVSFKGGDDMYKGLIVIYDTRRTPLISRSLIGFIKGHGDNPKPISFSFHKKFKQGPLLFVSNGLCCTYPFLFRSHMLFHNKDFCEILLVVYDFEQVDFDANVFY*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain