SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g11820): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g11820): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g11820

Feature Type:gene_model
Chromosome:Gm09
Start:12105499
stop:12107230
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G23710AT Annotation by Michelle Graham. TAIR10: DNA binding;DNA-directed RNA polymerases | chr5:7996528-7997220 REVERSE LENGTH=230 SoyBaseE_val: 2.00E-54ISS
GO:0006351GO-bp Annotation by Michelle Graham. GO Biological Process: transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003899GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA-directed RNA polymerase activity SoyBaseN/AISS
KOG3233 KOG RNA polymerase III, subunit C34 JGI ISS
PTHR12780Panther RNA POLYMERASE III (DNA DIRECTED), 39KD SUBUNIT-RELATED JGI ISS
PF05158PFAM RNA polymerase Rpc34 subunit JGI ISS
UniRef100_E6NUB2UniRef Annotation by Michelle Graham. Most informative UniRef hit: JHL06P13.1 protein n=1 Tax=Jatropha curcas RepID=E6NUB2_9ROSI SoyBaseE_val: 1.00E-83ISS
UniRef100_I1L271UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L271_SOYBN SoyBaseE_val: 4.00E-174ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g11820 not represented in the dataset

Glyma09g11820 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g089900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma09g11820.1   sequence type=CDS   gene model=Glyma09g11820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGAAAATTTTCTACCCTTCATCCTCACCTCCGCAGCAAGGGGAAAAGGCAAACAATGAGCGTTTTGCAAGGGAAGCGCAAGCGCCAAGTCTTGTTGGCATCGACGCAGTCATCGTCAATGAACAACGAGGAGCGCGCCGTGTACACGATCATTCGCGAGAGGAAGGAGATGGGGATATGGCAAGGAGACATCAAACGAGAGAAAAACATTCACATTCCCGATAGTCTGCTGAAGAAAACCCTAAAGATGCTCATCACCAAGAACCTCATCAAGGAGGTCGTCAACGTCCACAACAAGTCCAAGAAGCTTTTGATGGCGACCGACTTCGAACCCTCCAAGGAGATCAGCGGCGGAGAGTGGTACACCGACGGCAAATTCGACACCGAATTCATCGGTGCTCTGTCTGATGCTTGCTTGAGCAACATCCGCCGACGGAAAGTCGCGACGTGCGACGGGATCGTCGGGTGGATTAGGAAGGTGGGGAGTGATGTGTTCCCTGGTGGAGTTAGTAAAGGGCAGGTGGAGCAGATTTTGAAGAATTTGGTTATGGAGAATAAGGTTCAGGAGGTGACTAGTACTGGATTTGGGGATTTTGAGTCTGTTCCTGTTGGTGAAGTTTGTTATAGATTGGTGAAGAAGGGTGCTGGTGGTGTTGGTGCCATGGCTTCTATTCCTTGTGGGGTTTGTCCTAGGATTCATTCTTGTACACCTGATGGTGTTATCTCCCCTATGACTTGTCAATATTATCAGAAATGGTTGGACTTTTAA

>Glyma09g11820.1   sequence type=predicted peptide   gene model=Glyma09g11820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGKFSTLHPHLRSKGKRQTMSVLQGKRKRQVLLASTQSSSMNNEERAVYTIIRERKEMGIWQGDIKREKNIHIPDSLLKKTLKMLITKNLIKEVVNVHNKSKKLLMATDFEPSKEISGGEWYTDGKFDTEFIGALSDACLSNIRRRKVATCDGIVGWIRKVGSDVFPGGVSKGQVEQILKNLVMENKVQEVTSTGFGDFESVPVGEVCYRLVKKGAGGVGAMASIPCGVCPRIHSCTPDGVISPMTCQYYQKWLDF*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo