SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma09g11705

Feature Type:gene_model
Chromosome:Gm09
Start:11905460
stop:11905951
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
PF04434PFAM SWIM zinc finger JGI ISS
UniRef100_A2Q1A1UniRef Annotation by Michelle Graham. Most informative UniRef hit: FAR1; Zinc finger, SWIM-type n=1 Tax=Medicago truncatula RepID=A2Q1A1_MEDTR SoyBaseE_val: 1.00E-40ISS
UniRef100_I1L264UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1L264_SOYBN SoyBaseE_val: 2.00E-75ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g11705 not represented in the dataset

Glyma09g11705 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g089300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma09g11705.1   sequence type=CDS   gene model=Glyma09g11705   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAAAAATTGCATGTAATTGAGAACAATGATGCCAATGGGAGATTGCGAGAAGAGGTTTATAATCCTTCTGATCACAATGCAACTTGGTCATGCAAAATGTTTCAATCTCAAGGCATACCTTGTAGACATATACTTTGTGTCCTAAAAGGGAAAGGTTTAACTAAGATACCAAGTAATTATATTGTGAATAGGTGGACTAAATTGGCTAATAGAAAACCTATTTTTGATATTACTAACAATGACGTAGGCACGTTTTCTAAGTCAGAAAATGAGGGTAAGCTCATATTAGATGCATGGGGCCACTTCTTTAGGTGTATGGACAAGGCTGGACAACATAAGGAAAAATTGCTTCTTGTGATGAATGAAGTTGTGAACATTGCAAAACAACTAGCTGAGTATAAAGGGGATTCTAAACAAACAAAGACAAATGATTTACAAACCTTTGTTGGATCAAGCATTGCTAAAAAAGTGGGAATTCTTCCACCATAA

>Glyma09g11705.1   sequence type=predicted peptide   gene model=Glyma09g11705   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKKLHVIENNDANGRLREEVYNPSDHNATWSCKMFQSQGIPCRHILCVLKGKGLTKIPSNYIVNRWTKLANRKPIFDITNNDVGTFSKSENEGKLILDAWGHFFRCMDKAGQHKEKLLLVMNEVVNIAKQLAEYKGDSKQTKTNDLQTFVGSSIAKKVGILPP*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo