Glyma09g11615 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g11615

Feature Type:	gene_model
Chromosome:	Gm09
Start:	11743838
stop:	11744252
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g11615

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G28410	AT	Annotation by Michelle Graham. TAIR10: unknown protein; Has 18 Blast hits to 18 proteins in 5 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 18; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). \| chr2:12156202-12156549 FORWARD LENGTH=115	SoyBase	E_val: 9.00E-13	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0031225	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
UniRef100_Q9SKM9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=1 Tax=Arabidopsis thaliana RepID=Q9SKM9_ARATH	SoyBase	E_val: 4.00E-10	ISS
UniRef100_UPI000233D4C7	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233D4C7 related cluster n=1 Tax=unknown RepID=UPI000233D4C7	SoyBase	E_val: 2.00E-79	ISS

Expression Patterns of Glyma09g11615

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g11615 not represented in the dataset	Glyma09g11615 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g11615 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.09g088600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma09g11615

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g11615

Limit To All Plant Sequences

>Glyma09g11615.1   sequence type=CDS   gene model=Glyma09g11615   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAAAAAATAAACCAAGTATTTCTCCCTGTCTCTCACGGGCTTGTTTACGAGAGCCCTGTAGCTTTTCCACCAGTAGCATATGACTTATTTCATCCCAATGCTCAAAAGCCTGAGAACAAAGACCCGTGTGTTGCATCCAAATGTTCACCACTGCCTCTAGCAACTCAAGTGGATGCCACTCAAATATATGAAAACAAAGCTTCAACAACACAGAAAGGTGGGAAACAAATAGGAGGTGGGGGTGTAGCTGGCATTATCACTGCTGCTTTTGTTGTGCTTTTAGCTATGGGAATCTACTATGTAAAAGTCACTCGCCAAGCCTACATGAGTCGAGCCAGTAACAGTGTTCAATCTCATGCTTGA

Predicted protein sequences of Glyma09g11615

Limit To All Plant Sequences

>Glyma09g11615.1   sequence type=predicted peptide   gene model=Glyma09g11615   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKKINQVFLPVSHGLVYESPVAFPPVAYDLFHPNAQKPENKDPCVASKCSPLPLATQVDATQIYENKASTTQKGGKQIGGGGVAGIITAAFVVLLAMGIYYVKVTRQAYMSRASNSVQSHA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain