SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g11531

Feature Type:gene_model
Chromosome:Gm09
Start:11645002
stop:11645782
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g11531
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G22510AT Annotation by Michelle Graham. TAIR10: alkaline/neutral invertase | chr5:7474974-7477479 REVERSE LENGTH=617 SoyBaseE_val: 5.00E-53ISS
GO:0005982GO-bp Annotation by Michelle Graham. GO Biological Process: starch metabolic process SoyBaseN/AISS
GO:0005987GO-bp Annotation by Michelle Graham. GO Biological Process: sucrose catabolic process SoyBaseN/AISS
GO:0048825GO-bp Annotation by Michelle Graham. GO Biological Process: cotyledon development SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004564GO-mf Annotation by Michelle Graham. GO Molecular Function: beta-fructofuranosidase activity SoyBaseN/AISS
GO:0004575GO-mf Annotation by Michelle Graham. GO Molecular Function: sucrose alpha-glucosidase activity SoyBaseN/AISS
PF04853PFAM Plant neutral invertase JGI ISS
UniRef100_B9SSV6UniRef Annotation by Michelle Graham. Best UniRef hit: Beta-fructofuranosidase, putative n=1 Tax=Ricinus communis RepID=B9SSV6_RICCO SoyBaseE_val: 1.00E-53ISS
UniRef100_B9SSV6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Beta-fructofuranosidase, putative n=1 Tax=Ricinus communis RepID=B9SSV6_RICCO SoyBaseE_val: 1.00E-53ISS

Expression Patterns of Glyma09g11531
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g11531 not represented in the dataset
Glyma09g11531 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g11531 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g088100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma09g11531
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g11531
>Glyma09g11531.1   sequence type=CDS   gene model=Glyma09g11531   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATTGTCATAATCCAAGACAAGGTTTGATGCCTACTAGTTTTAAGGTTAGGACAGTTCCTTTGGACAGTGATGATTCTGCAACAAAAGAGGTTTTGGATCCTAACTTTGGAGAAGCATCCATTGGGCGTGTTGCTCCAGTTGATTCAATTTGGGAGAGAGTTGATGTGCAAATAGGAATTAAGATGATGTTGAAGTTATGTCTTGCTGATGGCTTTGACATGTTCCCAACCTTATTAGTAACTAATGGTTCTTGCATGATAGATCAAAGGATGGGAATTCATGGGCATCCTTTGGAGATTCAGGTATTTTCAACTTCATATTGA
Predicted protein sequences of Glyma09g11531
>Glyma09g11531.1   sequence type=predicted peptide   gene model=Glyma09g11531   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDCHNPRQGLMPTSFKVRTVPLDSDDSATKEVLDPNFGEASIGRVAPVDSIWERVDVQIGIKMMLKLCLADGFDMFPTLLVTNGSCMIDQRMGIHGHPLEIQVFSTSY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo