SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g09480): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g09480): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g09480

Feature Type:gene_model
Chromosome:Gm09
Start:9345723
stop:9346288
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G48320AT Annotation by Michelle Graham. TAIR10: Thioesterase superfamily protein | chr1:17855024-17855577 REVERSE LENGTH=156 SoyBaseE_val: 3.00E-42ISS
GO:0042372GO-bp Annotation by Michelle Graham. GO Biological Process: phylloquinone biosynthetic process SoyBaseN/AISS
GO:0005777GO-cc Annotation by Michelle Graham. GO Cellular Compartment: peroxisome SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016788GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on ester bonds SoyBaseN/AISS
GO:0047617GO-mf Annotation by Michelle Graham. GO Molecular Function: acyl-CoA hydrolase activity SoyBaseN/AISS
PTHR12418Panther FAMILY NOT NAMED JGI ISS
PTHR12418:SF10Panther JGI ISS
PF03061PFAM Thioesterase superfamily JGI ISS
UniRef100_G7IQD5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Esterase ydiI n=1 Tax=Medicago truncatula RepID=G7IQD5_MEDTR SoyBaseE_val: 4.00E-40ISS
UniRef100_I1L1Z6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L1Z6_SOYBN SoyBaseE_val: 7.00E-66ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g09480 not represented in the dataset

Glyma09g09480 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g080500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma09g09480.1   sequence type=CDS   gene model=Glyma09g09480   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGCTTTGGATCCACCCCTTTCATTCAATTGGGTTTGAAATTGAAAACTTTTCACCACAAAAATTCTCTGGTCATCTCCCTATCACCCAAAAATGTTGTCGACCATTTAAGGTGCTTCATGGAGGGGTATCAGCATTGATAGCAGAGTCTTTGGAAAGCATGGGAGCACATATGGCTTCTCGTTATAAAAGAATGGCTGGAATTCAACTAAGCATCAACCATTTGAAAAGAGCAAAGATTGGTGACTTGGTCCACGCAAAAGCTACACCTTTAAATGTTGGCAAAACCATTTAG

>Glyma09g09480.1   sequence type=predicted peptide   gene model=Glyma09g09480   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMLWIHPFHSIGFEIENFSPQKFSGHLPITQKCCRPFKVLHGGVSALIAESLESMGAHMASRYKRMAGIQLSINHLKRAKIGDLVHAKATPLNVGKTI*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo