Glyma09g09381 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g09381): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g09381): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g09381

Feature Type:	gene_model
Chromosome:	Gm09
Start:	9176161
stop:	9177473
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g09381

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G04560	AT	Annotation by Michelle Graham. TAIR10: HhH-GPD base excision DNA repair family protein \| chr5:1310671-1318091 FORWARD LENGTH=1729	SoyBase	E_val: 9.00E-47	ISS
GO:0006281	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA repair	SoyBase	N/A	ISS
GO:0006284	GO-bp	Annotation by Michelle Graham. GO Biological Process: base-excision repair	SoyBase	N/A	ISS
GO:0006306	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA methylation	SoyBase	N/A	ISS
GO:0006349	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of gene expression by genetic imprinting	SoyBase	N/A	ISS
GO:0009793	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0043078	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: polar nucleus	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0003906	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA-(apurinic or apyrimidinic site) lyase activity	SoyBase	N/A	ISS
GO:0004519	GO-mf	Annotation by Michelle Graham. GO Molecular Function: endonuclease activity	SoyBase	N/A	ISS
GO:0019104	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA N-glycosylase activity	SoyBase	N/A	ISS
GO:0051539	GO-mf	Annotation by Michelle Graham. GO Molecular Function: 4 iron, 4 sulfur cluster binding	SoyBase	N/A	ISS
PTHR10359	Panther	A/G-SPECIFIC ADENINE GLYCOSYLASE/ENDONUCLEASE III	JGI		ISS
PTHR10359:SF3	Panther	A/G-SPECIFIC ADENINE GLYCOSYLASE	JGI		ISS
UniRef100_B9MTP0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: DNA glycosylase (Fragment) n=1 Tax=Populus trichocarpa RepID=B9MTP0_POPTR	SoyBase	E_val: 7.00E-47	ISS
UniRef100_I1LCR4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LCR4_SOYBN	SoyBase	E_val: 1.00E-57	ISS

Expression Patterns of Glyma09g09381

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g09381 not represented in the dataset	Glyma09g09381 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g09381 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.09g079800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma09g09381

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g09381

Limit To All Plant Sequences

>Glyma09g09381.1   sequence type=CDS   gene model=Glyma09g09381   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGCAATGACAACACATGCTTTTCATGCAACAACATAAGGGAAGCCAATTCACAAATAGTTAGAGGAACACTTATGATACCTTTTAGGACAACAACTAGGGGAAGCTTTCCACTGAATGGAACTTACTTTCAAGTTAATGAGCTATTTGCGGATCAGGCATCTAGCGTTCAACCTATTGATATTCCTATGGAATGTATATGGAATTTTCCAAGGAGGCTAGTATACTTTGGGACCTCCGTATCATCTATTTTTAAAGGATTTGTTTGTGTAAGGGGATTTGATCAAAAGGAATGTGCACCCCATCCTCTATAG

Predicted protein sequences of Glyma09g09381

Limit To All Plant Sequences

>Glyma09g09381.1   sequence type=predicted peptide   gene model=Glyma09g09381   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MCNDNTCFSCNNIREANSQIVRGTLMIPFRTTTRGSFPLNGTYFQVNELFADQASSVQPIDIPMECIWNFPRRLVYFGTSVSSIFKGFVCVRGFDQKECAPHPL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain