SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g09370): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g09370): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g09370

Feature Type:gene_model
Chromosome:Gm09
Start:9168119
stop:9168859
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G48380AT Annotation by Michelle Graham. TAIR10: BAK1-interacting receptor-like kinase 1 | chr5:19604584-19606532 REVERSE LENGTH=620 SoyBaseE_val: 1.00E-115ISS
GO:0009627GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance SoyBaseN/AISS
GO:0009697GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process SoyBaseN/AISS
GO:0009863GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0031347GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of defense response SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0045087GO-bp Annotation by Michelle Graham. GO Biological Process: innate immune response SoyBaseN/AISS
GO:0060548GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of cell death SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
GO:0033612GO-mf Annotation by Michelle Graham. GO Molecular Function: receptor serine/threonine kinase binding SoyBaseN/AISS
KOG0580 KOG Serine/threonine protein kinase JGI ISS
PTHR24420Panther FAMILY NOT NAMED JGI ISS
PTHR24420:SF477Panther SUBFAMILY NOT NAMED JGI ISS
PF07714PFAM Protein tyrosine kinase JGI ISS
UniRef100_A2Q5X8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Probably inactive leucine-rich repeat receptor-like protein kinase n=1 Tax=Medicago truncatula RepID=A2Q5X8_MEDTR SoyBaseE_val: 3.00E-139ISS
UniRef100_I1L1Y6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L1Y6_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g09370 not represented in the dataset

Glyma09g09370 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g079700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma09g09370.1   sequence type=CDS   gene model=Glyma09g09370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGGCTACTGATAACTTCGGCAAAAGCAATATTATTGGGACTGGAAGATCAGGAACTGCTTACAAAGCTGTCCTTCATGATGGCACATCAGTCATGGTTAAGAGATTGCAGGAATCTCAACATTCAGAGAAAGAATTTCCATCTGAGATGAATATACTAGGGTCTGTCAAACATTGTAACTTGGTTTCACTTTTAGGTTTTTGCGTGGCTAAAAAGGAGAGGTTTTTGGTTTATAAAAATATGCCAAATGGTACCCTCCATGGTCAACTACACCCTGCTGCTGGTGCATGCACCATGGATTGGCCTCTAAGGCTCAAAATTGCAATTGGAGAAGCCAAGGGATTAGCATGGCTGAATCATAGTAGCAATCCTCGCATTATCCACCAAAACATAAGCTCTAAGTGCATCTTGTTGGATGCTGATTTTGAGCCCAAATTTTTTTATTTTGGTCTTGCTAGATTGATGAATCCAATTGATACACATTTGAGTACTTTTGTGAATGGGGAGTTTAGGGATTTAGGTTATGTTGTTCCTGAATATACAAAAACTTTGGTGGCTACTCCTAAAGGGGATATTTATAGCTTCGGGACCGTGCTTTTCGAGTTGGTGACAGGTGAAAGATCTACCCATGTGTCTAAAGCTCCAAAAACTTTTAAAGGAAATTTGGTAGAATGGATTCAACAGCAATCTAGCAATGCAAAACTCCATGAAGCCATTGATGAATCACTAGTTGGGTAG

>Glyma09g09370.1   sequence type=predicted peptide   gene model=Glyma09g09370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKATDNFGKSNIIGTGRSGTAYKAVLHDGTSVMVKRLQESQHSEKEFPSEMNILGSVKHCNLVSLLGFCVAKKERFLVYKNMPNGTLHGQLHPAAGACTMDWPLRLKIAIGEAKGLAWLNHSSNPRIIHQNISSKCILLDADFEPKFFYFGLARLMNPIDTHLSTFVNGEFRDLGYVVPEYTKTLVATPKGDIYSFGTVLFELVTGERSTHVSKAPKTFKGNLVEWIQQQSSNAKLHEAIDESLVG*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo