|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G08710 | AT | Annotation by Michelle Graham. TAIR10: thioredoxin H-type 9 | chr3:2645590-2646304 FORWARD LENGTH=140 | SoyBase | E_val: 4.00E-14 | ISS |
| GO:0006499 | GO-bp | Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation | SoyBase | N/A | ISS |
| GO:0006662 | GO-bp | Annotation by Michelle Graham. GO Biological Process: glycerol ether metabolic process | SoyBase | N/A | ISS |
| GO:0007154 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell communication | SoyBase | N/A | ISS |
| GO:0045454 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
| GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0009536 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plastid | SoyBase | N/A | ISS |
| GO:0009055 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: electron carrier activity | SoyBase | N/A | ISS |
| GO:0015035 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein disulfide oxidoreductase activity | SoyBase | N/A | ISS |
| UniRef100_C6TLK3 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Thioredoxin n=1 Tax=Glycine max RepID=C6TLK3_SOYBN | SoyBase | E_val: 4.00E-24 | ISS |
| UniRef100_UPI0001BA88D6 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI0001BA88D6 related cluster n=1 Tax=unknown RepID=UPI0001BA88D6 | SoyBase | E_val: 4.00E-24 | ISS |
|
Glyma09g09325 not represented in the dataset |
Glyma09g09325 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma09g09325.1 sequence type=CDS gene model=Glyma09g09325 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGCTGACATTGGTGGTCTTCCTTCTTTCAGGCTTCCATTCATTAAAACATACAAGTTTGTGGCTTTCAAACAATTATATGGGGAGTTATGTGTCTAAGAACAAAGCTAAGGATAATGATTCTGATCATAATGTGGATTTTGCTGCTGGGAATGTGAAACTTATTACCACCAAAGAAGCGTGGGACCAATATTTGGAAGAAGCAAGGAGGGCTGGCAAAATTGTAAGTTTCCCTCTTGTTTACTCTGTAGGACGGTAA
>Glyma09g09325.1 sequence type=predicted peptide gene model=Glyma09g09325 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MLTLVVFLLSGFHSLKHTSLWLSNNYMGSYVSKNKAKDNDSDHNVDFAAGNVKLITTKEAWDQYLEEARRAGKIVSFPLVYSVGR*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||