|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G10300 | AT | Annotation by Michelle Graham. TAIR10: RmlC-like cupins superfamily protein | chr4:6384564-6385946 FORWARD LENGTH=134 | SoyBase | E_val: 2.00E-54 | ISS |
| GO:0000023 | GO-bp | Annotation by Michelle Graham. GO Biological Process: maltose metabolic process | SoyBase | N/A | ISS |
| GO:0019252 | GO-bp | Annotation by Michelle Graham. GO Biological Process: starch biosynthetic process | SoyBase | N/A | ISS |
| GO:0019288 | GO-bp | Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
| PF05899 | PFAM | Protein of unknown function (DUF861) | JGI | ISS | |
| UniRef100_B6TP17 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Enzyme of the cupin superfamily n=1 Tax=Zea mays RepID=B6TP17_MAIZE | SoyBase | E_val: 3.00E-48 | ISS |
| UniRef100_C6SYR7 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SYR7_SOYBN | SoyBase | E_val: 2.00E-64 | ISS |
|
Glyma09g08993 not represented in the dataset |
Glyma09g08993 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.09g076900 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma09g08993.1 sequence type=CDS gene model=Glyma09g08993 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGACTACTGTCATAGAAAAATTGGGCATATGCCCAATTAAGATTGAGAGGAACCCTCCTGAGTCCAAGCTCACTCAACTGGGTGTTAGGCAATGGCCCAAATGGGGTTGCCCTCCAAGTAAGTTCCCATGGACATATGAAGCCAAAGAGACTTGCTATCTTCTGGAAGGAAAAGTGAAGGTCTTTCCTAGTGGGTCGAATGAGTCAGTTGAAATTGCTGCTGGTGACTTGGTTGTGTTTCCCAAAGGGATGAGTTGCACTTGGGATGTGTCTGTTGGTGTTGACAAGCACTATAATTTTGAATAA
>Glyma09g08993.1 sequence type=predicted peptide gene model=Glyma09g08993 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MTTVIEKLGICPIKIERNPPESKLTQLGVRQWPKWGCPPSKFPWTYEAKETCYLLEGKVKVFPSGSNESVEIAAGDLVVFPKGMSCTWDVSVGVDKHYNFE*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||