|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT5G13930 | AT | Annotation by Michelle Graham. TAIR10: Chalcone and stilbene synthase family protein | chr5:4488762-4490035 FORWARD LENGTH=395 | SoyBase | E_val: 3.00E-23 | ISS |
GO:0006979 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to oxidative stress | SoyBase | N/A | ISS |
GO:0008152 | GO-bp | Annotation by Michelle Graham. GO Biological Process: metabolic process | SoyBase | N/A | ISS |
GO:0009058 | GO-bp | Annotation by Michelle Graham. GO Biological Process: biosynthetic process | SoyBase | N/A | ISS |
GO:0009411 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to UV | SoyBase | N/A | ISS |
GO:0009611 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to wounding | SoyBase | N/A | ISS |
GO:0009629 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to gravity | SoyBase | N/A | ISS |
GO:0009715 | GO-bp | Annotation by Michelle Graham. GO Biological Process: chalcone biosynthetic process | SoyBase | N/A | ISS |
GO:0009718 | GO-bp | Annotation by Michelle Graham. GO Biological Process: anthocyanin-containing compound biosynthetic process | SoyBase | N/A | ISS |
GO:0009733 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus | SoyBase | N/A | ISS |
GO:0009744 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus | SoyBase | N/A | ISS |
GO:0009753 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus | SoyBase | N/A | ISS |
GO:0009813 | GO-bp | Annotation by Michelle Graham. GO Biological Process: flavonoid biosynthetic process | SoyBase | N/A | ISS |
GO:0009926 | GO-bp | Annotation by Michelle Graham. GO Biological Process: auxin polar transport | SoyBase | N/A | ISS |
GO:0010224 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to UV-B | SoyBase | N/A | ISS |
GO:0031540 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of anthocyanin biosynthetic process | SoyBase | N/A | ISS |
GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
GO:0005783 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum | SoyBase | N/A | ISS |
GO:0009705 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plant-type vacuole membrane | SoyBase | N/A | ISS |
GO:0003824 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: catalytic activity | SoyBase | N/A | ISS |
GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS |
GO:0016210 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: naringenin-chalcone synthase activity | SoyBase | N/A | ISS |
GO:0016746 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring acyl groups | SoyBase | N/A | ISS |
GO:0016747 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring acyl groups other than amino-acyl groups | SoyBase | N/A | ISS |
PF00195 | PFAM | Chalcone and stilbene synthases, N-terminal domain | JGI | ISS | |
UniRef100_P24826 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Chalcone synthase 1 n=5 Tax=Glycine max RepID=CHS1_SOYBN | SoyBase | E_val: 2.00E-31 | ISS |
UniRef100_UPI000233D094 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233D094 related cluster n=1 Tax=unknown RepID=UPI000233D094 | SoyBase | E_val: 3.00E-35 | ISS |
Glyma09g08751 not represented in the dataset |
Glyma09g08751 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.09g074900 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma09g08751.1 sequence type=CDS gene model=Glyma09g08751 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGTGAGTGTTGAAGAGATTCATAAGGCACAACGTGCAGAAGGCTCTGCCATCGTGATGGCTATTGGCACGGCCACTCCTCCCAACTGCGTGGATCAGAGTACCTATCCTGACTATTATCTTCGCATCACCAACAGTGACCACATGACCGAGCTCAAAGAAAAGTTCAAGCGCATGTGTGAGTGCAAGAGACATCCATTTATAGATGACTTTGAGAATAACATTACCTCACAAATTCAATGCTATTCCATCAAATTGCCAGCAACCAACCCTCTTGAGGGAATGGAATAA
>Glyma09g08751.1 sequence type=predicted peptide gene model=Glyma09g08751 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MVSVEEIHKAQRAEGSAIVMAIGTATPPNCVDQSTYPDYYLRITNSDHMTELKEKFKRMCECKRHPFIDDFENNITSQIQCYSIKLPATNPLEGME*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||