Glyma09g08722 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g08722): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g08722): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g08722

Feature Type:	gene_model
Chromosome:	Gm09
Start:	8071257
stop:	8071818
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g08722

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G18010	AT	Annotation by Michelle Graham. TAIR10: myo-inositol polyphosphate 5-phosphatase 2 \| chr4:9991194-9994099 REVERSE LENGTH=613	SoyBase	E_val: 6.00E-41	ISS
GO:0007165	GO-bp	Annotation by Michelle Graham. GO Biological Process: signal transduction	SoyBase	N/A	ISS
GO:0009414	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to water deprivation	SoyBase	N/A	ISS
GO:0009611	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to wounding	SoyBase	N/A	ISS
GO:0009723	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus	SoyBase	N/A	ISS
GO:0009733	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus	SoyBase	N/A	ISS
GO:0009737	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus	SoyBase	N/A	ISS
GO:0009738	GO-bp	Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009753	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus	SoyBase	N/A	ISS
GO:0009845	GO-bp	Annotation by Michelle Graham. GO Biological Process: seed germination	SoyBase	N/A	ISS
GO:0032957	GO-bp	Annotation by Michelle Graham. GO Biological Process: inositol trisphosphate metabolic process	SoyBase	N/A	ISS
GO:0042538	GO-bp	Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response	SoyBase	N/A	ISS
GO:0046854	GO-bp	Annotation by Michelle Graham. GO Biological Process: phosphatidylinositol phosphorylation	SoyBase	N/A	ISS
GO:0046855	GO-bp	Annotation by Michelle Graham. GO Biological Process: inositol phosphate dephosphorylation	SoyBase	N/A	ISS
GO:0052542	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response by callose deposition	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0004445	GO-mf	Annotation by Michelle Graham. GO Molecular Function: inositol-polyphosphate 5-phosphatase activity	SoyBase	N/A	ISS
PTHR11200	Panther	INOSITOL 5-PHOSPHATASE	JGI		ISS
PTHR11200:SF29	Panther	INOSITOL PHOSPHATASE SKIP	JGI		ISS
PF03372	PFAM	Endonuclease/Exonuclease/phosphatase family	JGI		ISS
UniRef100_G7JZV2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Type I inositol-1,4,5-trisphosphate 5-phosphatase n=1 Tax=Medicago truncatula RepID=G7JZV2_MEDTR	SoyBase	E_val: 1.00E-56	ISS
UniRef100_I1J9L1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1J9L1_SOYBN	SoyBase	E_val: 3.00E-68	ISS

Expression Patterns of Glyma09g08722

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g08722 not represented in the dataset	Glyma09g08722 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g08722 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.09g074600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma09g08722

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g08722

Limit To All Plant Sequences

>Glyma09g08722.1   sequence type=CDS   gene model=Glyma09g08722   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGCATGTATTTGATGGATGGAAACAGGGGTTGATAAACTTCCCACCCACTTACAAGTATGAAATTAACTGTGATAGATATGTTGGTGAGAGGCCGAAACAAGGGGAAAAAAGAAGATCTCCAGCCTGGTGTGATCGTATATTGTGCCTAGGCAAAGGAATAAAACAACTACAATATGGACGTGCAGAAATTAAGCTCTCGGATCATAGACCAGTTAGTTCAGCCTTGTTGGTTGAAGTTGAAGTATTCGACCATCGCAAGCTAAAGAGAGCTCTAAATTTCACTAGGGCAGCAGTACACCTAGAGATCTTCCTTGATGAAGATGGAGAAATATAA

Predicted protein sequences of Glyma09g08722

Limit To All Plant Sequences

>Glyma09g08722.1   sequence type=predicted peptide   gene model=Glyma09g08722   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGHVFDGWKQGLINFPPTYKYEINCDRYVGERPKQGEKRRSPAWCDRILCLGKGIKQLQYGRAEIKLSDHRPVSSALLVEVEVFDHRKLKRALNFTRAAVHLEIFLDEDGEI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain