Glyma09g08706 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g08706): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g08706): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g08706

Feature Type:	gene_model
Chromosome:	Gm09
Start:	8055519
stop:	8059958
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g08706

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G51000	AT	Annotation by Michelle Graham. TAIR10: alpha/beta-Hydrolases superfamily protein \| chr3:18945258-18946499 REVERSE LENGTH=323	SoyBase	E_val: 7.00E-21	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0004301	GO-mf	Annotation by Michelle Graham. GO Molecular Function: epoxide hydrolase activity	SoyBase	N/A	ISS
PTHR10992	Panther	ALPHA/BETA HYDROLASE RELATED	JGI		ISS
PTHR10992:SF279	Panther	EPOXIDE HYDROLASE-RELATED	JGI		ISS
PF00561	PFAM	alpha/beta hydrolase fold	JGI		ISS
UniRef100_B4UW64	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Epoxide hydrolase (Fragment) n=1 Tax=Arachis hypogaea RepID=B4UW64_ARAHY	SoyBase	E_val: 6.00E-90	ISS
UniRef100_UPI000233D091	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233D091 related cluster n=1 Tax=unknown RepID=UPI000233D091	SoyBase	E_val: 8.00E-141	ISS

Expression Patterns of Glyma09g08706

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g08706 not represented in the dataset	Glyma09g08706 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g08706 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.09g074500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma09g08706

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g08706

Limit To All Plant Sequences

>Glyma09g08706.1   sequence type=CDS   gene model=Glyma09g08706   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATTGCTATAGCAAAAGCTGGCTACTGGGCTATTGCCTTTGATTTCAGAGGCTATGGACTTTCTCAGCATCCTGCGGAGCCACAAAAAGCAAACTTACTTGACCTTGTTGATGATGTCGTGGGTTTGTTGGCTTCACTAAGCATTACCAAGGCTAATTGTATGTGCTTGTTGGTAGTTAAGGACTTTGGTGCCTTTCCAGGATATATTGTTACCTCTCTCCATCCAGACAAAGTAGATTCAGTCATAATGTTAGGTGTTCCATTCATGCTTCCAGGTCCCTCTGCTATTGAAAACCTCCCAAAAGGCTCCTACGTTATTAAGTGGCAGGAGGCTGGGAGGGCAAAAACAGATTTTGTTCGCTTTGATGTTAAGTCAGTTATAAGGAACATCTACACACTCTTCTCTGGAAGTGAGATACCAATAGCAGGTGATAATCAGGAAATCATGGATTTGTATGACCCAACTACTCCCCTACCACCATGGTTCTCCGAGGAAGACCTGACAACCTATGCATCACTATACGAAAAATCTGGCTTCAGATTTGCATTGCAGGTTCCATACAGGACTCTTGGAGTGGATAGTGGC

Predicted protein sequences of Glyma09g08706

Limit To All Plant Sequences

>Glyma09g08706.1   sequence type=predicted peptide   gene model=Glyma09g08706   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIAIAKAGYWAIAFDFRGYGLSQHPAEPQKANLLDLVDDVVGLLASLSITKANCMCLLVVKDFGAFPGYIVTSLHPDKVDSVIMLGVPFMLPGPSAIENLPKGSYVIKWQEAGRAKTDFVRFDVKSVIRNIYTLFSGSEIPIAGDNQEIMDLYDPTTPLPPWFSEEDLTTYASLYEKSGFRFALQVPYRTLGVDSG

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain