|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G06520 | AT | Annotation by Michelle Graham. TAIR10: photosystem II subunit X | chr2:2587868-2588218 REVERSE LENGTH=116 | SoyBase | E_val: 2.00E-27 | ISS |
| GO:0015979 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0009523 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: photosystem II | SoyBase | N/A | ISS |
| GO:0009535 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
| PF06596 | PFAM | Photosystem II reaction centre X protein (PsbX) | JGI | ISS | |
| UniRef100_C1K5D2 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Chloroplast photosystem II subunit X n=1 Tax=Vigna radiata RepID=C1K5D2_VIGRA | SoyBase | E_val: 2.00E-42 | ISS |
| UniRef100_C6SWQ2 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SWQ2_SOYBN | SoyBase | E_val: 8.00E-79 | ISS |
|
Glyma09g08630 not represented in the dataset |
Glyma09g08630 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.09g073900 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma09g08630.1 sequence type=CDS gene model=Glyma09g08630 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCTTCCACTTCTGCAGTTTCATTGGCTATGCCAGTAACTTATGCCAGCCAGAAGAGGGTACTGGTGCCTAGCTCTGATGCATTATTCCTCAAGCCACTGCCTCTACGTTCTTATTCTTCCAAGGCAATGGCAGCATCAAAAGTACCCAATGGAAGGTTTCAGGTGAGGGCTTCCATGAAGGAGAAAGTTGTGACAGGCCTCACAGCAGCTGCATTCACAGCCTCAATGATGGCTCCTGATGTGGCCGAGGCCGCCGTTTCGCCTTCTCTCAAGAACTTCTTGCTCAGCATCGCCGCCGGTGGTGTTGTTGTTGCTGCCATTATCGGTGCGGTGGTCGGGGTTTCCAATTTCGATCCCGTCAAGCGAAGCTGA
>Glyma09g08630.1 sequence type=predicted peptide gene model=Glyma09g08630 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MASTSAVSLAMPVTYASQKRVLVPSSDALFLKPLPLRSYSSKAMAASKVPNGRFQVRASMKEKVVTGLTAAAFTASMMAPDVAEAAVSPSLKNFLLSIAAGGVVVAAIIGAVVGVSNFDPVKRS*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||