SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g08620): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g08620): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g08620

Feature Type:gene_model
Chromosome:Gm09
Start:7944800
stop:7946131
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g08620
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G28840AT Annotation by Michelle Graham. TAIR10: GDP-D-mannose 3',5'-epimerase | chr5:10862472-10864024 REVERSE LENGTH=377 SoyBaseE_val: 2.00E-46ISS
GO:0009225GO-bp Annotation by Michelle Graham. GO Biological Process: nucleotide-sugar metabolic process SoyBaseN/AISS
GO:0019853GO-bp Annotation by Michelle Graham. GO Biological Process: L-ascorbic acid biosynthetic process SoyBaseN/AISS
GO:0044237GO-bp Annotation by Michelle Graham. GO Biological Process: cellular metabolic process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0047918GO-mf Annotation by Michelle Graham. GO Molecular Function: GDP-mannose 3,5-epimerase activity SoyBaseN/AISS
GO:0050662GO-mf Annotation by Michelle Graham. GO Molecular Function: coenzyme binding SoyBaseN/AISS
GO:0051287GO-mf Annotation by Michelle Graham. GO Molecular Function: NAD binding SoyBaseN/AISS
PTHR10366Panther NAD DEPENDENT EPIMERASE/DEHYDRATASE JGI ISS
PTHR10366:SF35Panther gb def: udp-glucose 4-epimerase [bacillus halodurans] JGI ISS
UniRef100_B9VU69UniRef Annotation by Michelle Graham. Most informative UniRef hit: GDP-mannose-3',5'-epimerase n=1 Tax=Caragana korshinskii RepID=B9VU69_9FABA SoyBaseE_val: 3.00E-48ISS
UniRef100_I1L1U9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1L1U9_SOYBN SoyBaseE_val: 6.00E-107ISS

Expression Patterns of Glyma09g08620
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g08620 not represented in the dataset
Glyma09g08620 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g08620 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma09g08620
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g08620
>Glyma09g08620.1   sequence type=CDS   gene model=Glyma09g08620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TTACTTCTTCAATCTAAATTTTTTATTTCGAATTCAATTGAGGTTGCTATTACCCTAATTTCGGTTTTGAATCTCGTAGATTTTGAACTTGCACTTTTCATTATGTTAAGTTATTTTAAGGAGTTTCCAATTTGGGAACACGATATGTTGATATTATGGTCTGTTGTTTTGTTTAGATTGACTAAATCCAACTTCCGAGAGCCAGTAAATATTGGAAGCGATGAGATGGTTAGCATGAATGAGATGGCTGAGATTATTCTTGGCTTTGAGAACAAGAATATTCCTATTCACCACATTCCTGGCCCTGAGGGTGTTCGAGGTCGTAATTCAGACAATACACTAATAAAAGAAAAACTTGGTTGGGCTCCAACTATGAGGTTGAAGATTAAGGAGCATATCGAGAAGGAGAAGGCTCAAGGTATTGATATATCTGTGTATGGGTCTAAATTATTTGTTAAGGTGGTTTTTTAA
Predicted protein sequences of Glyma09g08620
>Glyma09g08620.1   sequence type=predicted peptide   gene model=Glyma09g08620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LLLQSKFFISNSIEVAITLISVLNLVDFELALFIMLSYFKEFPIWEHDMLILWSVVLFRLTKSNFREPVNIGSDEMVSMNEMAEIILGFENKNIPIHHIPGPEGVRGRNSDNTLIKEKLGWAPTMRLKIKEHIEKEKAQGIDISVYGSKLFVKVVF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo