SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g08521): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g08521): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g08521

Feature Type:gene_model
Chromosome:Gm09
Start:7792397
stop:7793748
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g08521
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G75850AT Annotation by Michelle Graham. TAIR10: VPS35 homolog B | chr1:28478053-28483874 REVERSE LENGTH=790 SoyBaseE_val: 8.00E-36ISS
GO:0006886GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular protein transport SoyBaseN/AISS
GO:0042147GO-bp Annotation by Michelle Graham. GO Biological Process: retrograde transport, endosome to Golgi SoyBaseN/AISS
PTHR11099Panther VACUOLAR SORTING PROTEIN 35 JGI ISS
PF03635PFAM Vacuolar protein sorting-associated protein 35 JGI ISS
UniRef100_B9R8C3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Vacuolar sorting protein, putative n=1 Tax=Ricinus communis RepID=B9R8C3_RICCO SoyBaseE_val: 1.00E-41ISS
UniRef100_UPI000233EAD4UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233EAD4 related cluster n=1 Tax=unknown RepID=UPI000233EAD4 SoyBaseE_val: 4.00E-54ISS

Expression Patterns of Glyma09g08521
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g08521 not represented in the dataset
Glyma09g08521 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g08521 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g073500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma09g08521
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g08521
>Glyma09g08521.1   sequence type=CDS   gene model=Glyma09g08521   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTATCATCTTGATCATGAAGCAAATAAAGTTATGGCCATGGTTATTATCCAAAGCATTACGAAGAATAACACTTGCATCTCTACTTTCGATAAGGTTGCAGTTTTATTTGAACTAATCAAAGGGCTTATAATGGACTTGGATGGAACAACTCTGGATGATGTTGATGAAGAAGATTTCAATGAGGAGCAAAATTGTGTCGCTCGCCTCATACGCATGCTTCATAATGATGAACCAGAGGAAATGTTTAAGATAACGATAATTATGTTCATATTGATCAGACAATTGCAAGGGCAGGATGGAAATATAGTGGGAGAAGAAGCTCCTACAACACCAAAAACAATATTTTAG
Predicted protein sequences of Glyma09g08521
>Glyma09g08521.1   sequence type=predicted peptide   gene model=Glyma09g08521   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MYHLDHEANKVMAMVIIQSITKNNTCISTFDKVAVLFELIKGLIMDLDGTTLDDVDEEDFNEEQNCVARLIRMLHNDEPEEMFKITIIMFILIRQLQGQDGNIVGEEAPTTPKTIF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo