Glyma09g08428 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g08428

Feature Type:	gene_model
Chromosome:	Gm09
Start:	7678912
stop:	7679487
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g08428

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G41980	AT	Annotation by Michelle Graham. TAIR10: CONTAINS InterPro DOMAIN/s: Putative harbinger transposase-derived nuclease (InterPro:IPR006912); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G43722.1); Has 1807 Blast hits to 1807 proteins in 277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink). \| chr5:16793765-16794889 FORWARD LENGTH=374	SoyBase	E_val: 4.00E-22	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0016788	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on ester bonds	SoyBase	N/A	ISS
UniRef100_UPI00023385A1	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI00023385A1 related cluster n=1 Tax=unknown RepID=UPI00023385A1	SoyBase	E_val: 6.00E-126	ISS

Expression Patterns of Glyma09g08428

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g08428 not represented in the dataset	Glyma09g08428 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g08428 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma09g08428

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g08428

Limit To All Plant Sequences

>Glyma09g08428.1   sequence type=CDS   gene model=Glyma09g08428   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAAGTAGTATAGTTAATGCTTCGGCTACTTCAAGAAAACGTAGAAGAGATGAAGAGGAGGAAGAAGAACTTGAACAAATATTTTTCATTATTGTTAGTGTTGTCACTATGCTTTTGGGTGCACTGACTTGGTATCATGACAAGTATTTTGTTAAGGAACCTGCCCGAAATTTGGAATTAGAAAGGCATAGTTTCCTCAATCGTCTATACAGGGGAACAGAAACTGATTGCATTGAACAATTAAGGGTCAGTAAAAAGGCATTTTTTAAGCTTTGTAGAATTTTACAAGAGAAAGGGCAATTGGTAAAAACAAAAAATGTTCCTATAGATGAAGCTGTGGCAATGTTTTTGCATATCCTTGCTCACAACCTAAAGTATAGAGTTGTGCACTTTAGTTATTGTAGATCCATGGAAACAATTAGTAGGCAATTCAAGAATGTCCTGCGAGCTATAATGAAAGTAAGCAAAGAATATTTGAAGTTCTATGAGTATAATCTAGAGGGCTCGGTGGAAAACAAATGGAGATGGTTTAAGGTAAGTTTGTCATTTGTTAGTAATTATAAGGTACTTTAA

Predicted protein sequences of Glyma09g08428

Limit To All Plant Sequences

>Glyma09g08428.1   sequence type=predicted peptide   gene model=Glyma09g08428   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MESSIVNASATSRKRRRDEEEEEELEQIFFIIVSVVTMLLGALTWYHDKYFVKEPARNLELERHSFLNRLYRGTETDCIEQLRVSKKAFFKLCRILQEKGQLVKTKNVPIDEAVAMFLHILAHNLKYRVVHFSYCRSMETISRQFKNVLRAIMKVSKEYLKFYEYNLEGSVENKWRWFKVSLSFVSNYKVL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain