Glyma09g08061 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g08061

Feature Type:	gene_model
Chromosome:	Gm09
Start:	7082800
stop:	7083894
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g08061

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G35570	AT	Annotation by Michelle Graham. TAIR10: O-fucosyltransferase family protein \| chr5:13750101-13753383 REVERSE LENGTH=652	SoyBase	E_val: 4.00E-32	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0016757	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups	SoyBase	N/A	ISS
PF10250	PFAM	GDP-fucose protein O-fucosyltransferase	JGI		ISS
UniRef100_I1L1P7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L1P7_SOYBN	SoyBase	E_val: 3.00E-43	ISS
UniRef100_Q9FH12	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Axi 1 (Auxin-independent growth promoter)-like protein n=1 Tax=Arabidopsis thaliana RepID=Q9FH12_ARATH	SoyBase	E_val: 1.00E-29	ISS

Expression Patterns of Glyma09g08061

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g08061 not represented in the dataset	Glyma09g08061 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g08061 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.09g069200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma09g08061

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g08061

Limit To All Plant Sequences

>Glyma09g08061.1   sequence type=CDS   gene model=Glyma09g08061   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTGTTGTTGCTAAGATTATGAAGGCAACACTTGTTCTTCCTTCTCTTGATAACACCTCTTATTGGGGTGATGCAAGTGGCTTCAAGGATTTATTTGATTGGAAATATTTTATTGAGACACTGAAGGATGATGATATCCACGTAGTTGAGACATTACCACCTACCTATGCTGAAATTGAACCTTTCTCAAAAACTTCAATATCTTGGTCAAAGGTCAACATAAATTGCCTATCTCCAATTACATCTTTTTTAAATCCAAAATGA

Predicted protein sequences of Glyma09g08061

Limit To All Plant Sequences

>Glyma09g08061.1   sequence type=predicted peptide   gene model=Glyma09g08061   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVVVAKIMKATLVLPSLDNTSYWGDASGFKDLFDWKYFIETLKDDDIHVVETLPPTYAEIEPFSKTSISWSKVNINCLSPITSFLNPK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain