|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G20630 | AT | Annotation by Michelle Graham. TAIR10: germin 3 | chr5:6975315-6975950 REVERSE LENGTH=211 | SoyBase | E_val: 6.00E-12 | ISS |
| GO:0009409 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cold | SoyBase | N/A | ISS |
| GO:0010103 | GO-bp | Annotation by Michelle Graham. GO Biological Process: stomatal complex morphogenesis | SoyBase | N/A | ISS |
| GO:0018119 | GO-bp | Annotation by Michelle Graham. GO Biological Process: peptidyl-cysteine S-nitrosylation | SoyBase | N/A | ISS |
| GO:0019684 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction | SoyBase | N/A | ISS |
| GO:0030003 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular cation homeostasis | SoyBase | N/A | ISS |
| GO:0042742 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response to bacterium | SoyBase | N/A | ISS |
| GO:0070838 | GO-bp | Annotation by Michelle Graham. GO Biological Process: divalent metal ion transport | SoyBase | N/A | ISS |
| GO:0005576 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: extracellular region | SoyBase | N/A | ISS |
| GO:0005618 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cell wall | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0009505 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall | SoyBase | N/A | ISS |
| GO:0031012 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: extracellular matrix | SoyBase | N/A | ISS |
| GO:0048046 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: apoplast | SoyBase | N/A | ISS |
| GO:0030145 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: manganese ion binding | SoyBase | N/A | ISS |
| GO:0045735 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nutrient reservoir activity | SoyBase | N/A | ISS |
| PF00190 | PFAM | Cupin | JGI | ISS | |
| UniRef100_C7S8C4 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Germin-like protein 10 n=1 Tax=Glycine max RepID=C7S8C4_SOYBN | SoyBase | E_val: 5.00E-14 | ISS |
| UniRef100_I1L1P3 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L1P3_SOYBN | SoyBase | E_val: 8.00E-94 | ISS |
|
Glyma09g08030 not represented in the dataset |
Glyma09g08030 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma09g08030.1 sequence type=CDS gene model=Glyma09g08030 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAGGATGATTCTAACCCTCTTCTTCATCATCTCATCCCTCCTCTCCCTCTCCCACGCCTCCGTGATTTCTGCGTACCGGCAACACCTCAAACATCATCAAGGTCGCGGTGACGCCGGCCTTCGACGACGCGCAATTCTCCGGCGTAAAAGGCCTGGGAATCTCCATTGCGCGCCTAGACCTAGCACCTGGTGGAGTCATCCCACTCCACACTCACCCTGGAGCCTCAGAACTACTGTTGTTGTGAAGGGAAAAATCTGCACCGGCTTCATTGCTTCGGACAACACTGTGTACCTCAAAACCCTAGAAAAAGGTGATGTCATGGTGTACCCTCAAGGGTTGTTAATGCTCAACCAAAGCACCGAGATGTTATTGGCCCTATGGGTTATGTTATGTATTCTAGGATAA
>Glyma09g08030.1 sequence type=predicted peptide gene model=Glyma09g08030 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MRMILTLFFIISSLLSLSHASVISAYRQHLKHHQGRGDAGLRRRAILRRKRPGNLHCAPRPSTWWSHPTPHSPWSLRTTVVVKGKICTGFIASDNTVYLKTLEKGDVMVYPQGLLMLNQSTEMLLALWVMLCILG*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||