SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g07990

Feature Type:gene_model
Chromosome:Gm09
Start:7003261
stop:7005873
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g07990
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G13960AT Annotation by Michelle Graham. TAIR10: growth-regulating factor 5 | chr3:4608526-4610160 FORWARD LENGTH=397 SoyBaseE_val: 1.00E-52ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0009845GO-bp Annotation by Michelle Graham. GO Biological Process: seed germination SoyBaseN/AISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0009965GO-bp Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis SoyBaseN/AISS
GO:0010162GO-bp Annotation by Michelle Graham. GO Biological Process: seed dormancy process SoyBaseN/AISS
GO:0016570GO-bp Annotation by Michelle Graham. GO Biological Process: histone modification SoyBaseN/AISS
GO:0048366GO-bp Annotation by Michelle Graham. GO Biological Process: leaf development SoyBaseN/AISS
GO:0048449GO-bp Annotation by Michelle Graham. GO Biological Process: floral organ formation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016818GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides SoyBaseN/AISS
PF08879PFAM WRC JGI ISS
PF08880PFAM QLQ JGI ISS
UniRef100_G7L6U2UniRef Annotation by Michelle Graham. Most informative UniRef hit: GRL2 n=1 Tax=Medicago truncatula RepID=G7L6U2_MEDTR SoyBaseE_val: 2.00E-54ISS
UniRef100_I1L1P0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L1P0_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma09g07990
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma09g07990
ParalogEvidenceComments
Glyma15g19460 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma09g07990 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g068700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma09g07990
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g07990
>Glyma09g07990.1   sequence type=CDS   gene model=Glyma09g07990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGAATGGAAGAAACAGGTTTCCCTTTACCCCATCACAGTGGCAAGAGCTTGAACACCAAGCTCTCATCTACAAGTACATGGCTTCAGGCATTTCCATTCCCCCTGATCTTCTCTTCACCATAAAAAGGAGCTATTTTGATTCCCCTCTCTCCTCAAGGCTTTTGCCTAACCAGCCACAACACTTTGGATGGAACTACCTTCAGATGGGTTTGGGAAGAAAAATAGACCCTGAGCCAGGTAGGTGTAGAAGAACTGATGGCAAGAAATGGAGATGCTCAAAAGAAGCATACCCAGATTCTAAGTACTGTGAGAGGCACATGCACAGAGGGAAGAATCGTTCAAGAAAGCCTGTGGAAGTTTTGAAAACAACAACACCATCATCAACAATGACAACAACAAACACAAACTCAAATGCTTCTTCAACACAACAAGCAATCTCATCAATCACCAAAATTAATACTCTTTCACCTCTTGCTTCATCTGAGACTCACCAACACCACCCTCAACACTATGGCTCCTTTCTCTATCATCATCACCCTCCTTCAAGGTCCTCTGGCATTGGCTTGTCCTTTGAAGATAATAGGGCTCCCTTGTTTCTTGACACTGGCTCTTGCTCTCAGTCCAACACAGACTGCAGGAGTAGGTATGTTTATGGAGAGAAAGAGGAGGTGGATGAGCATGCTTTCTTCACAGAACCTTGTGGTGTTATGAAAAGCTTCTCTGCTTCCTCTATGGATGACTCATGGCAACTCACACCATTGACTATGAGTTCCTCATCTTCTTCTTCCAAACAGAGGAGTTCCTTTGGCTTGTCCAGTGATTACTCTTGCTTGCAACTTCAGAGCCACTCAAAGCAGCAGCAACAAGAGCATCATCAAGATCAGGGTTGCTACATGTTTGGTGGTGGTCAAGTTGTGAAAGAAGAACCTCAGAAAACGGTTCATCGCTTCTTTGATGAATGGCCCCACAAAGGAAGAGAAGGGTCTTGGCTTGATTTGGATGACAAATCTTCCACAACCCAACTTTCAATTTCCATCCCCACATGTTCTCATGATTTTCCAACTTTCAGTTCTAGAAACCACCACGATGGTTGA
Predicted protein sequences of Glyma09g07990
>Glyma09g07990.1   sequence type=predicted peptide   gene model=Glyma09g07990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMNGRNRFPFTPSQWQELEHQALIYKYMASGISIPPDLLFTIKRSYFDSPLSSRLLPNQPQHFGWNYLQMGLGRKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVEVLKTTTPSSTMTTTNTNSNASSTQQAISSITKINTLSPLASSETHQHHPQHYGSFLYHHHPPSRSSGIGLSFEDNRAPLFLDTGSCSQSNTDCRSRYVYGEKEEVDEHAFFTEPCGVMKSFSASSMDDSWQLTPLTMSSSSSSSKQRSSFGLSSDYSCLQLQSHSKQQQQEHHQDQGCYMFGGGQVVKEEPQKTVHRFFDEWPHKGREGSWLDLDDKSSTTQLSISIPTCSHDFPTFSSRNHHDG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo