Glyma09g07920 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g07920): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g07920): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g07920

Feature Type:	gene_model
Chromosome:	Gm09
Start:	6903763
stop:	6909121
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g07920

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G06530	AT	Annotation by Michelle Graham. TAIR10: SNF7 family protein \| chr2:2588740-2590285 REVERSE LENGTH=225	SoyBase	E_val: 8.00E-131	ISS
GO:0009644	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to high light intensity	SoyBase	N/A	ISS
GO:0010200	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to chitin	SoyBase	N/A	ISS
GO:0015031	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein transport	SoyBase	N/A	ISS
GO:0016192	GO-bp	Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport	SoyBase	N/A	ISS
GO:0042542	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide	SoyBase	N/A	ISS
GO:0048193	GO-bp	Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport	SoyBase	N/A	ISS
GO:0000815	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: ESCRT III complex	SoyBase	N/A	ISS
GO:0005771	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: multivesicular body	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
KOG3230	KOG	Vacuolar assembly/sorting protein DID4	JGI		ISS
PTHR10476	Panther	SNF7-RELATED	JGI		ISS
PTHR10476:SF4	Panther	BC-2 - RELATED	JGI		ISS
PF03357	PFAM	Snf7	JGI		ISS
UniRef100_I1L1N3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L1N3_SOYBN	SoyBase	E_val: 5.00E-158	ISS
UniRef100_Q9SKI2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Vacuolar protein sorting-associated protein 2 homolog 1 n=2 Tax=Arabidopsis RepID=VPS2A_ARATH	SoyBase	E_val: 4.00E-128	ISS

Expression Patterns of Glyma09g07920

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g07920 not represented in the dataset	Glyma09g07920 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g07920 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.09g068000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma09g07920

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g07920

Limit To All Plant Sequences

>Glyma09g07920.1   sequence type=CDS   gene model=Glyma09g07920   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTTTCATCTTCGGAAAGCGAAAAACACCCGCAGAGCTTCTGCGGGAAAATAAGAGGATGCTGGACAAATCAATCAGAGAAATTGAGCGCGAGCGGCAAGGCTTGCAAACGCAAGAGAAGAAATTGATTGCGGAGATAAAGAAAAGTGCCAAACAGGGCCAGATGGGAGCTGTTAGAGTTATGGCAAAAGATCTTGTTAGAACAAGGCATCAGGTTGAGAAATTTTATAAGCTAAAATCTCAGCTCCAAGGTGTATCACTCAGAATTCAGACTTTGAAATCAACACAAGCAATGGGTGAGGCTATGAAAGGCGTGACAAAGGCCATGGGGCAAATGAATAGGCAGATGAACTTGCCATCATTGCAGAAAATCATGCAAGAATTTGAGAGACAGAATGAGAAGATGGAATTGACATCTGAGATGATGGGAGATGCAATAGATGATGCTTTGGAAGGAGAAGAAGATGAAGAGGAAACTGAAGACCTAGTTAACCAAGTTCTTGATGAGATTGGCATTGACATTAACCAAGAGCTTGTAAATGCACCATCATCAGCTGTTGCTGCCCCGGCTGCAAAGACAAAGGTACCACAAGTTGAAACGACTGGGAATGATGATGGAGGGATAGATAGTGATTTACAGGCAAGGTTAGACAATTTAAGAAAGATGTAA

Predicted protein sequences of Glyma09g07920

Limit To All Plant Sequences

>Glyma09g07920.1   sequence type=predicted peptide   gene model=Glyma09g07920   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSFIFGKRKTPAELLRENKRMLDKSIREIERERQGLQTQEKKLIAEIKKSAKQGQMGAVRVMAKDLVRTRHQVEKFYKLKSQLQGVSLRIQTLKSTQAMGEAMKGVTKAMGQMNRQMNLPSLQKIMQEFERQNEKMELTSEMMGDAIDDALEGEEDEEETEDLVNQVLDEIGIDINQELVNAPSSAVAAPAAKTKVPQVETTGNDDGGIDSDLQARLDNLRKM*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain