SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g07803): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g07803): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g07803

Feature Type:gene_model
Chromosome:Gm09
Start:6807007
stop:6807607
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g07803
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G67170AT Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G14750.1); Has 5478 Blast hits to 4354 proteins in 533 species: Archae - 87; Bacteria - 653; Metazoa - 2554; Fungi - 380; Plants - 418; Viruses - 16; Other Eukaryotes - 1370 (source: NCBI BLink). | chr1:25127727-25129145 FORWARD LENGTH=359 SoyBaseE_val: 4.00E-30ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_G9I822UniRef Annotation by Michelle Graham. Most informative UniRef hit: Structural maintenance of chromosomes domain-containing protein n=1 Tax=Citrus sinensis RepID=G9I822_CITSI SoyBaseE_val: 6.00E-13ISS
UniRef100_UPI000233F3ECUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233F3EC related cluster n=1 Tax=unknown RepID=UPI000233F3EC SoyBaseE_val: 7.00E-53ISS

Expression Patterns of Glyma09g07803
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g07803 not represented in the dataset
Glyma09g07803 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g07803 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma09g07803
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g07803
>Glyma09g07803.1   sequence type=CDS   gene model=Glyma09g07803   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCGCCGCCCCCTCACCTGCGGCGGCCGCACCCGCAGGACCCCGCCGCAATGCTGCTCCCGATCGTGGTGCCGTTTGATTTGCTCCCTCCGCCTCAGGTGATGAAGGAGAAGCTGGCGCCACAGCATGCGGAGATGCAATGTCTGGCGACAGAGAACCAGCGCCTGGCCGCGACGCACAGTGTGCTGCGGCAGGAGCTGGCGGTGGCGCAACATGAGATGCAGATGCTTCACGGGCACATGGTGGCGCTGAAGAGGGAGCGGGAGCAGCAGATTCGTGCGCAGCTGGAGAAGATCGTGAAAATGGAAAGTGAGGCGCAGGGCTCGGAGAGCGTGAAGATAGAGTTGCAGTAG
Predicted protein sequences of Glyma09g07803
>Glyma09g07803.1   sequence type=predicted peptide   gene model=Glyma09g07803   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSPPPHLRRPHPQDPAAMLLPIVVPFDLLPPPQVMKEKLAPQHAEMQCLATENQRLAATHSVLRQELAVAQHEMQMLHGHMVALKREREQQIRAQLEKIVKMESEAQGSESVKIELQ*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo