SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g07440): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g07440): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g07440

Feature Type:gene_model
Chromosome:Gm09
Start:6324039
stop:6327254
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g07440
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G64280AT Annotation by Michelle Graham. TAIR10: regulatory protein (NPR1) | chr1:23853329-23855407 REVERSE LENGTH=593 SoyBaseE_val: 1.00E-171ISS
GO:0000165GO-bp Annotation by Michelle Graham. GO Biological Process: MAPK cascade SoyBaseN/AISS
GO:0002679GO-bp Annotation by Michelle Graham. GO Biological Process: respiratory burst involved in defense response SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0007154GO-bp Annotation by Michelle Graham. GO Biological Process: cell communication SoyBaseN/AISS
GO:0008219GO-bp Annotation by Michelle Graham. GO Biological Process: cell death SoyBaseN/AISS
GO:0009408GO-bp Annotation by Michelle Graham. GO Biological Process: response to heat SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009410GO-bp Annotation by Michelle Graham. GO Biological Process: response to xenobiotic stimulus SoyBaseN/AISS
GO:0009595GO-bp Annotation by Michelle Graham. GO Biological Process: detection of biotic stimulus SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009617GO-bp Annotation by Michelle Graham. GO Biological Process: response to bacterium SoyBaseN/AISS
GO:0009625GO-bp Annotation by Michelle Graham. GO Biological Process: response to insect SoyBaseN/AISS
GO:0009627GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance SoyBaseN/AISS
GO:0009682GO-bp Annotation by Michelle Graham. GO Biological Process: induced systemic resistance SoyBaseN/AISS
GO:0009697GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process SoyBaseN/AISS
GO:0009738GO-bp Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009863GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0010112GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of systemic acquired resistance SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0010310GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0016045GO-bp Annotation by Michelle Graham. GO Biological Process: detection of bacterium SoyBaseN/AISS
GO:0030968GO-bp Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response SoyBaseN/AISS
GO:0031347GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of defense response SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0035304GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0043069GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death SoyBaseN/AISS
GO:0043900GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of multi-organism process SoyBaseN/AISS
GO:0045087GO-bp Annotation by Michelle Graham. GO Biological Process: innate immune response SoyBaseN/AISS
GO:0045088GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of innate immune response SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0050776GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of immune response SoyBaseN/AISS
GO:0050832GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus SoyBaseN/AISS
GO:0051707GO-bp Annotation by Michelle Graham. GO Biological Process: response to other organism SoyBaseN/AISS
GO:2000022GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:2000031GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PF00651PFAM BTB/POZ domain JGI ISS
PF11900PFAM Domain of unknown function (DUF3420) JGI ISS
PF12313PFAM NPR1/NIM1 like defence protein C terminal JGI ISS
UniRef100_G7IQ63UniRef Annotation by Michelle Graham. Most informative UniRef hit: NPR1 n=1 Tax=Medicago truncatula RepID=G7IQ63_MEDTR SoyBaseE_val: 0ISS
UniRef100_UPI000233CEFBUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233CEFB related cluster n=1 Tax=unknown RepID=UPI000233CEFB SoyBaseE_val: 0ISS

Expression Patterns of Glyma09g07440
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g07440 not represented in the dataset
Glyma09g07440 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g07440 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g064700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma09g07440
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g07440
>Glyma09g07440.1   sequence type=CDS   gene model=Glyma09g07440   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAACTTCAGAAGCGGCTCCTCGGATTCAAAGGACGCCAGTAACAGCAGCACCGGCGAGGCCTATTTGAGCGGCGTTTCGGACGTCATCACGCCGCTGAGGCGCCTCTCGGAGCAGCTCGGGTCAATATTAGATGGCGGGGGGGTTGACTTTTTCTCCGACGCCAAGATCGTGGCCGGAGACGGCCGGGAAGTGGCGGTGAACCGGTGCATTCTGGCGGCCAGGAGCGGCTTCTTCAAGCATGTCTTCGCCGGTGGTGGCGGCTGCGTGCTCCGGCTGAAGGAAGTGGCCAAGGACTACAACGTGGGGTTGGAGGCGCTTGGGATTGTTTTGGCTTATTTGTATAGTGGAAGAGTGAAGCCTTTGCCTCAAGGTGGTGTTTGTGTTTGTGTGGATGATGGACATCTACTAGACATTCTTGAAAAGGTGGCAATAGATGATATTTTGGTGGTTCTATCGGTCGCAAATATATGTGGCATAGTGTGTGAAAGACTACTAGCAAGGTGCACTGAGATGATACTTAAATCTGATGCTGATATCACCACTCTTGAAAAGGCACTGCCTCAACATTTGGTGAAGCAAATCACAGATAAACGAATAGAACTGGACCTGTACATGCCCGAAAACTTCAATTTTCCTGACAAACATGTCAACAGAATACACAGGGCACTGGATTCGGACGATGTGGAACTGGTAAGATTGCTTTTGAAAGAGGGACACACAACTCTTGATGATGCTTATGCACTCCACTATGCTGTTGCATACTGTGATGTGAAGACCACCACTGAGCTTCTTGATCTTGGTCTTGCTGATGTGAACCACAAAAACTATAGGGGCTATAGTGTGCTGCATGTTGCTGCAATGAGGAAGGAGCCTAAGATTATAGTTTCTCTCTTGACTAAGGGGGCACAGCCTTCTGATCTCACTTTGGATGGAAGAAAAGCCCTTCAGATTTCGAAACGTCTCACCAAAGCTGTGGATTATTATAAGTCCACAGAGGAAGGAAAAGTTTCATGCAGTGACAGGTTGTGCATAGAGATATTGGAGCAAGCTGAGAGAAGGGAGCCTTTACTTGGAGAGGCATCTCTTTCTCTTGCTATGGCAGGGGATGATTTGCGCATGAAACTGTTGTACCTAGAAAATAGAGTTGGACTGGCGAAAGTGTTGTTTCCCATGGAAGCAAAGGTTATTATGGATATTTCTCAAATTGATGGCACATCTGAGTTTCCATCAACAGACATGTACTGTCCAAATATTAGTGATCACCAGAGGACAACTGTGGACTTAAACGATGCACCTTTCAGAATGAAGGAAGAACATCTAGTTAGGTTGAGAGCACTGTCTAGAACTGTGGAGTTGGGGAAACGCTTCTTCCCTCGATGCTCAGAAGTGTTGAACAAGATCATGGATGCTGATGACCTAACTCAGCTTACATGTATGGGTGATGACAGTCCCGAAGATCGACTAAGGAAGCGAAGAAGGTATGTGGAGCTCCAAGAAGTTCTGAATAAGGTCTTCAATGAGGACAAGGAGGAGTTTGATAGGTCTGCCATGTCATCATCATCCTCTTCTACATCAATTGGAGTAGTGAGACCTAATGCCAATCTAGCCATGAAGAACTAG
Predicted protein sequences of Glyma09g07440
>Glyma09g07440.1   sequence type=predicted peptide   gene model=Glyma09g07440   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNFRSGSSDSKDASNSSTGEAYLSGVSDVITPLRRLSEQLGSILDGGGVDFFSDAKIVAGDGREVAVNRCILAARSGFFKHVFAGGGGCVLRLKEVAKDYNVGLEALGIVLAYLYSGRVKPLPQGGVCVCVDDGHLLDILEKVAIDDILVVLSVANICGIVCERLLARCTEMILKSDADITTLEKALPQHLVKQITDKRIELDLYMPENFNFPDKHVNRIHRALDSDDVELVRLLLKEGHTTLDDAYALHYAVAYCDVKTTTELLDLGLADVNHKNYRGYSVLHVAAMRKEPKIIVSLLTKGAQPSDLTLDGRKALQISKRLTKAVDYYKSTEEGKVSCSDRLCIEILEQAERREPLLGEASLSLAMAGDDLRMKLLYLENRVGLAKVLFPMEAKVIMDISQIDGTSEFPSTDMYCPNISDHQRTTVDLNDAPFRMKEEHLVRLRALSRTVELGKRFFPRCSEVLNKIMDADDLTQLTCMGDDSPEDRLRKRRRYVELQEVLNKVFNEDKEEFDRSAMSSSSSSTSIGVVRPNANLAMKN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo