SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g07351): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g07351): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g07351

Feature Type:gene_model
Chromosome:Gm09
Start:6186840
stop:6188034
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G18110AT Annotation by Michelle Graham. TAIR10: Translation elongation factor EF1B/ribosomal protein S6 family protein | chr2:7872636-7873713 FORWARD LENGTH=231 SoyBaseE_val: 2.00E-42ISS
GO:0006414GO-bp Annotation by Michelle Graham. GO Biological Process: translational elongation SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005853GO-cc Annotation by Michelle Graham. GO Cellular Compartment: eukaryotic translation elongation factor 1 complex SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0003746GO-mf Annotation by Michelle Graham. GO Molecular Function: translation elongation factor activity SoyBaseN/AISS
KOG1668 KOG Elongation factor 1 beta/delta chain JGI ISS
PTHR11595Panther ELONGATION FACTOR 1-BETA JGI ISS
PTHR11595:SF5Panther ELONGATION FACTOR 1-BETA JGI ISS
PF00736PFAM EF-1 guanine nucleotide exchange domain JGI ISS
UniRef100_E1CKY6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Elongation factor 1 beta n=1 Tax=Vigna unguiculata RepID=E1CKY6_VIGUN SoyBaseE_val: 4.00E-49ISS
UniRef100_UPI000233CEF7UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233CEF7 related cluster n=1 Tax=unknown RepID=UPI000233CEF7 SoyBaseE_val: 3.00E-78ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g07351 not represented in the dataset

Glyma09g07351 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g063800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma09g07351.1   sequence type=CDS   gene model=Glyma09g07351   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGTGACATTGTACGACCTTAGCTCTGCCTCTGGGTTGAAGAAGCTTGATCAGTACCTTCTCCCACGCACATTGCCAACTGCTCCATCACATGAATATGTGAATGTGTCCAGGTGGTACAAGCACATTGATGCCTTGTTGAGAATATCTGGTGTTTCTGGTGAGGGATCTCTTGTTGCAGCTCCCCCAACTGCAGACACAAAGGCAACTGGAAAGTCATCTGTTATGTTGGATGTGAAACCTTGGGATGATGAAACTGACATGAAGAAGCTCGAGGAAGCAGTAAGATCTATTGAGATGGAAGGGTTGCTTTTTGGTGCATTTTCTGTCGACGATCGTATTGAGGAACGTCTCACAGTCGAGCCCATCAATGAATATGTCCAATAA

>Glyma09g07351.1   sequence type=predicted peptide   gene model=Glyma09g07351   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAVTLYDLSSASGLKKLDQYLLPRTLPTAPSHEYVNVSRWYKHIDALLRISGVSGEGSLVAAPPTADTKATGKSSVMLDVKPWDDETDMKKLEEAVRSIEMEGLLFGAFSVDDRIEERLTVEPINEYVQ*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo