|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G18110 | AT | Annotation by Michelle Graham. TAIR10: Translation elongation factor EF1B/ribosomal protein S6 family protein | chr2:7872636-7873713 FORWARD LENGTH=231 | SoyBase | E_val: 2.00E-42 | ISS |
| GO:0006414 | GO-bp | Annotation by Michelle Graham. GO Biological Process: translational elongation | SoyBase | N/A | ISS |
| GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
| GO:0005853 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: eukaryotic translation elongation factor 1 complex | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0003746 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: translation elongation factor activity | SoyBase | N/A | ISS |
| KOG1668 | KOG | Elongation factor 1 beta/delta chain | JGI | ISS | |
| PTHR11595 | Panther | ELONGATION FACTOR 1-BETA | JGI | ISS | |
| PTHR11595:SF5 | Panther | ELONGATION FACTOR 1-BETA | JGI | ISS | |
| PF00736 | PFAM | EF-1 guanine nucleotide exchange domain | JGI | ISS | |
| UniRef100_E1CKY6 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Elongation factor 1 beta n=1 Tax=Vigna unguiculata RepID=E1CKY6_VIGUN | SoyBase | E_val: 4.00E-49 | ISS |
| UniRef100_UPI000233CEF7 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233CEF7 related cluster n=1 Tax=unknown RepID=UPI000233CEF7 | SoyBase | E_val: 3.00E-78 | ISS |
|
Glyma09g07351 not represented in the dataset |
Glyma09g07351 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.09g063800 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma09g07351.1 sequence type=CDS gene model=Glyma09g07351 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCAGTGACATTGTACGACCTTAGCTCTGCCTCTGGGTTGAAGAAGCTTGATCAGTACCTTCTCCCACGCACATTGCCAACTGCTCCATCACATGAATATGTGAATGTGTCCAGGTGGTACAAGCACATTGATGCCTTGTTGAGAATATCTGGTGTTTCTGGTGAGGGATCTCTTGTTGCAGCTCCCCCAACTGCAGACACAAAGGCAACTGGAAAGTCATCTGTTATGTTGGATGTGAAACCTTGGGATGATGAAACTGACATGAAGAAGCTCGAGGAAGCAGTAAGATCTATTGAGATGGAAGGGTTGCTTTTTGGTGCATTTTCTGTCGACGATCGTATTGAGGAACGTCTCACAGTCGAGCCCATCAATGAATATGTCCAATAA
>Glyma09g07351.1 sequence type=predicted peptide gene model=Glyma09g07351 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MAVTLYDLSSASGLKKLDQYLLPRTLPTAPSHEYVNVSRWYKHIDALLRISGVSGEGSLVAAPPTADTKATGKSSVMLDVKPWDDETDMKKLEEAVRSIEMEGLLFGAFSVDDRIEERLTVEPINEYVQ*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||