SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g07310

Feature Type:gene_model
Chromosome:Gm09
Start:6157088
stop:6157613
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g07310
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G34430AT Annotation by Michelle Graham. TAIR10: light-harvesting chlorophyll-protein complex II subunit B1 | chr2:14524818-14525618 FORWARD LENGTH=266 SoyBaseE_val: 3.00E-58ISS
GO:0009765GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light harvesting SoyBaseN/AISS
GO:0009769GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light harvesting in photosystem II SoyBaseN/AISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0010287GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastoglobule SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0030076GO-cc Annotation by Michelle Graham. GO Cellular Compartment: light-harvesting complex SoyBaseN/AISS
GO:0042651GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid membrane SoyBaseN/AISS
GO:0016168GO-mf Annotation by Michelle Graham. GO Molecular Function: chlorophyll binding SoyBaseN/AISS
PTHR21649Panther CHLOROPHYLL A/B BINDING PROTEIN JGI ISS
PF00504PFAM Chlorophyll A-B binding protein JGI ISS
UniRef100_E0D588UniRef Annotation by Michelle Graham. Most informative UniRef hit: Chlorophyll a/b binding protein-like protein (Fragment) n=1 Tax=Torenia fournieri RepID=E0D588_9LAMI SoyBaseE_val: 4.00E-63ISS
UniRef100_UPI000233CEF5UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233CEF5 related cluster n=1 Tax=unknown RepID=UPI000233CEF5 SoyBaseE_val: 8.00E-64ISS

Expression Patterns of Glyma09g07310
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g07310 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.16g162600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma09g07310
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g07310
>Glyma09g07310.1   sequence type=CDS   gene model=Glyma09g07310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTGCTGTTGAGGGTTACCGTATTGCTGGTGGGCCTCTCGGTGAAGTGACTGACCCAATCTACCCAGGTGGCAGCTTTGACCCATTGGGCCTTGCTGATGACCCAGAGGCTTTTGCTGAGTTGAAGGTGAAAGAGCTCAAGAATGGTAGGTTGGCCATGTTCTCCATGTTTGGTTTCTTTGTTCAGGCCATTGTGACAGGAAAGGGACCTTTGGAAAATCTTGCTGATCACCTAGCTGACCCAGTAAACAATAATGCCTGGGCCTATGCTACAAACTTTGTCCCCGGAAAGTGA
Predicted protein sequences of Glyma09g07310
>Glyma09g07310.1   sequence type=predicted peptide   gene model=Glyma09g07310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo