SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g07281

Feature Type:gene_model
Chromosome:Gm09
Start:6139094
stop:6141762
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g07281
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G11545AT Annotation by Michelle Graham. TAIR10: xyloglucan endotransglucosylase/hydrolase 8 | chr1:3878689-3880286 REVERSE LENGTH=305 SoyBaseE_val: 4.00E-33ISS
GO:0005975GO-bp Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process SoyBaseN/AISS
GO:0006073GO-bp Annotation by Michelle Graham. GO Biological Process: cellular glucan metabolic process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0004553GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds SoyBaseN/AISS
GO:0016762GO-mf Annotation by Michelle Graham. GO Molecular Function: xyloglucan:xyloglucosyl transferase activity SoyBaseN/AISS
GO:0016798GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on glycosyl bonds SoyBaseN/AISS
PF00722PFAM Glycosyl hydrolases family 16 JGI ISS
UniRef100_C0IRG0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Xyloglucan endotransglucosylase/hydrolase 1 n=1 Tax=Actinidia eriantha RepID=C0IRG0_ACTER SoyBaseE_val: 1.00E-32ISS
UniRef100_C6TH50UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TH50_SOYBN SoyBaseE_val: 1.00E-34ISS

Expression Patterns of Glyma09g07281
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g07281 not represented in the dataset
Glyma09g07281 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g07281 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma09g07281
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g07281
>Glyma09g07281.1   sequence type=CDS   gene model=Glyma09g07281   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGCTCAGAAAATGGTGCAGGGCCAGAAAAAGATGAGCTTGATTTTGAGTTTTTGGGGAACAAAACAGGAAAGCCTTATTTGATTCAGACTAATGTATACAAGAATGGGATTGGTGGACGTAAGATGAGGCACATGCTTTGGTTTGACCCCACAGAGGACTACCACACCTATTCCATTCACGAGGGAAGAATTAGAATGAGATCATGTTAA
Predicted protein sequences of Glyma09g07281
>Glyma09g07281.1   sequence type=predicted peptide   gene model=Glyma09g07281   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MCSENGAGPEKDELDFEFLGNKTGKPYLIQTNVYKNGIGGRKMRHMLWFDPTEDYHTYSIHEGRIRMRSC*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo