SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g07070

Feature Type:gene_model
Chromosome:Gm09
Start:5909046
stop:5911259
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g07070
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G25810AT Annotation by Michelle Graham. TAIR10: xyloglucan endotransglycosylase 6 | chr4:13128694-13129715 FORWARD LENGTH=286 SoyBaseE_val: 7.00E-140ISS
GO:0005975GO-bp Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process SoyBaseN/AISS
GO:0006073GO-bp Annotation by Michelle Graham. GO Biological Process: cellular glucan metabolic process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0004553GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds SoyBaseN/AISS
GO:0016762GO-mf Annotation by Michelle Graham. GO Molecular Function: xyloglucan:xyloglucosyl transferase activity SoyBaseN/AISS
GO:0016798GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on glycosyl bonds SoyBaseN/AISS
PTHR10963Panther SECRETED GLUCOSIDASE-RELATED JGI ISS
PTHR10963:SF14Panther BETA-GLUCANASE JGI ISS
PF00722PFAM Glycosyl hydrolases family 16 JGI ISS
PF06955PFAM Xyloglucan endo-transglycosylase (XET) C-terminus JGI ISS
UniRef100_G7IIF3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Xyloglucan endotransglucosylase/hydrolase n=1 Tax=Medicago truncatula RepID=G7IIF3_MEDTR SoyBaseE_val: 3.00E-147ISS
UniRef100_UPI0001B6396CUniRef Annotation by Michelle Graham. Best UniRef hit: UPI0001B6396C related cluster n=1 Tax=unknown RepID=UPI0001B6396C SoyBaseE_val: 0ISS

Expression Patterns of Glyma09g07070
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma09g07070
ParalogEvidenceComments
Glyma15g18360 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma09g07070 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g062600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma09g07070
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g07070
>Glyma09g07070.1   sequence type=CDS   gene model=Glyma09g07070   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGAAAAATATTGGGTTGTTTCTTCTTGTGGTGGTGGCTACTTTTGTGGTGGCAGCCACAGCTGGTAGCTTTTACCAAGACTTTGAAATAACATGGGGTGGTGAGCGTGCCAAAATCTATGAAAATGGAAATCTTCTCACCCTCTCCCTAGACAGAGCCTCTGGCTCTGGCTTTCGTTCCAAAAAAGAATACTTGTTCGGAAAAATTGACATGCAGCTCAAGCTCGTGCCTGGTAACTCTGCTGGAACAGTCACTGCCTATTATTTATCTTCTCTGGGGCCTACTCATGACGAAATAGACTTCGAGTTTTTGGGTAACTTGAGTGGTGATCCTTATACTCTCCACACGAACGTATTCAGCCAAGGGAAAGGGAACAGAGAACAACAGTTCCATCTATGGTTCGACCCCACCAAGGACTTCCACACATACTCCGTCCAATGGAATCCTGCAAGCATCATATTCTCTGTGGACGGGACACCAATAAGGGAGTTCAAGAATTTGGAGACAAAAGGGGTTCCTTTCCCAAAGAACCAACCCATGAGAATATACTCTAGCCTTTGGAACGCTGAGGATTGGGCCACAAGGGGTGGGCTTGTGAAAACGGATTGGAGCAAGGCCCCATTCACAGCCTCATACAGAAACTTCAATGCCCTAACCTCTTCCTCCACTGGCCAATCACTGGACGCCACGGGGCTGGCCAAGATCCATTGGGTGCAAAAGAATTACATGATTTACAACTATTGCACTGATATTAGACGTTTCCCACAAGGCCTCCCTCCAGAATGTTCCATTGCTTGA
Predicted protein sequences of Glyma09g07070
>Glyma09g07070.1   sequence type=predicted peptide   gene model=Glyma09g07070   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMKNIGLFLLVVVATFVVAATAGSFYQDFEITWGGERAKIYENGNLLTLSLDRASGSGFRSKKEYLFGKIDMQLKLVPGNSAGTVTAYYLSSLGPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGNREQQFHLWFDPTKDFHTYSVQWNPASIIFSVDGTPIREFKNLETKGVPFPKNQPMRIYSSLWNAEDWATRGGLVKTDWSKAPFTASYRNFNALTSSSTGQSLDATGLAKIHWVQKNYMIYNYCTDIRRFPQGLPPECSIA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo