SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g06650): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g06650): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g06650

Feature Type:gene_model
Chromosome:Gm09
Start:5395163
stop:5400484
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G53970AT Annotation by Michelle Graham. TAIR10: proteasome inhibitor-related | chr3:19985208-19987132 FORWARD LENGTH=302 SoyBaseE_val: 1.00E-88ISS
GO:0042023GO-bp Annotation by Michelle Graham. GO Biological Process: DNA endoreduplication SoyBaseN/AISS
GO:0043161GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0043248GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome assembly SoyBaseN/AISS
GO:0051510GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of unidimensional cell growth SoyBaseN/AISS
GO:0051788GO-bp Annotation by Michelle Graham. GO Biological Process: response to misfolded protein SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG4761 KOG Proteasome formation inhibitor PI31 JGI ISS
PTHR13266Panther PROTEASOME INHIBITOR JGI ISS
PTHR13266:SF1Panther PROTEASOME INHIBITOR JGI ISS
PF08577PFAM PI31 proteasome regulator JGI ISS
PF11566PFAM Proteasome Inhibitor PI31 JGI ISS
UniRef100_B9T883UniRef Annotation by Michelle Graham. Most informative UniRef hit: Proteasome inhibitor, putative n=1 Tax=Ricinus communis RepID=B9T883_RICCO SoyBaseE_val: 2.00E-92ISS
UniRef100_C6TJP8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TJP8_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g06650 not represented in the dataset

Glyma09g06650 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma15g17840 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g059100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma09g06650.1   sequence type=CDS   gene model=Glyma09g06650   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGAGTGAAAAGTTGGTGCTGGCAGTGATCAGGGCCGCGAGGCCAACCTTCCGCAACCAAAACGACAAAATCGCATTTGCCGTTCACTCCTCCTTCCTCACCTCCGGCTATGTCCTCACCGCTACAGGTCCCCAGGCCCTCTCCGACAATGCGTTTTCTGACCCATCCAATGACGAGGTATCCGTTGATCATTGGAACGAGCTGAACGATGAGTACGCGTTCGTTTACGCGAATCCAGAAAAGGGTTCGGAGAAAGTGCTTGTCAAGTGCCTCGTGATGAACGACAAATTGCTCGTTCATGCTTTTACTCAAGGATCTTCGGAGCCTTTGAGCCTTGAGATTGATGTTGGGGATTATGCTGGAGAGGATGGAGTCAGCAATTATTCTCAGCAGTTCAAGAATTTGGATAAGCTTGTGAAGAAAATAGATGGGGATATCTTGTCTAAATTAGATGGTTCTGCTAAAGCCAGCTCATCAAGTAGAAGCTCAGAAACAAGTAACAGAACTAGACAAGAGATACCTGATCCTGTTGCTGGATTTGGTGAACCTGGTGGTCCTCCAACGCAATTTATTTTCCCTTCAGTTCCCATTGGTTCTGGTAGTGATCTTGTTCCTGGGCCTGCTGCTGGAGTGTTTCCTTCAAGGGGTGGTCATGGCATTGGTGGAAGCATGCTTGTAGGGCCTAATGACCCCCGTTGGTTTGGTGGTGTTGGTGGTATTGGTGGAGATCCTGCTTTTCCTGGAGGATTGCCGGGTGTTCCTCCCGGTGCGCGATTTGATCCATATGGACCTCCCGGTGTTCCTGGTTTTGAACCCAACAGATTTGCAAGGAATCCTAGGAGGCCAGGATATGACACTCATCCAGATTGGCAACATTTTCGGAGAGATGCTGATTCAGACTACATATAG

>Glyma09g06650.1   sequence type=predicted peptide   gene model=Glyma09g06650   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASEKLVLAVIRAARPTFRNQNDKIAFAVHSSFLTSGYVLTATGPQALSDNAFSDPSNDEVSVDHWNELNDEYAFVYANPEKGSEKVLVKCLVMNDKLLVHAFTQGSSEPLSLEIDVGDYAGEDGVSNYSQQFKNLDKLVKKIDGDILSKLDGSAKASSSSRSSETSNRTRQEIPDPVAGFGEPGGPPTQFIFPSVPIGSGSDLVPGPAAGVFPSRGGHGIGGSMLVGPNDPRWFGGVGGIGGDPAFPGGLPGVPPGARFDPYGPPGVPGFEPNRFARNPRRPGYDTHPDWQHFRRDADSDYI*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo