Glyma09g06550 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g06550

Feature Type:	gene_model
Chromosome:	Gm09
Start:	5314919
stop:	5315639
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g06550

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G30074	AT	Annotation by Michelle Graham. TAIR10: low-molecular-weight cysteine-rich 19 \| chr4:14699844-14700560 REVERSE LENGTH=126	SoyBase	E_val: 2.00E-19	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
PF07333	PFAM	S locus-related glycoprotein 1 binding pollen coat protein (SLR1-BP)	JGI		ISS
UniRef100_I1L1C4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L1C4_SOYBN	SoyBase	E_val: 3.00E-92	ISS
UniRef100_P82733	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Defensin-like protein 183 n=1 Tax=Arabidopsis thaliana RepID=DF183_ARATH	SoyBase	E_val: 1.00E-16	ISS

Expression Patterns of Glyma09g06550

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma09g06550

Paralog	Evidence	Comments
Glyma15g17730	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma09g06550 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.09g058200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma09g06550

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g06550

Limit To All Plant Sequences

>Glyma09g06550.1   sequence type=CDS   gene model=Glyma09g06550   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGAACCGCATCTCAAACTATGTTCCTCTCTTCATCATTTTGATTGTTTTGGTAACAGTGCAAAAACAAGTGGAAGGATTGACATGTTCGAGATATTTCGGTTTATGTTCCGACACGAGAAATTGTGATCTTAGGTGTAAAGCCCGCAATAAGCATGCAGAGGGGCACTGTGATGATGACTTCAACTGTACTTGTATTTACCCTTGTGACTCTCCTCAGCCAAATAAAGACACCGAGCCTATAAGGAAGTGCACTAGTGGCCTTGGACTTTGCAGTGTTGATCACTGCTATGATGATTGTTGCAATTCAAAATGTGCTAAACAATTCAAAGAGGGTATAGGACATTGTGAAATAGTGGGTTCGATGGGTACCATCTTGTGTACCTGTGATTATGTCTGCTGA

Predicted protein sequences of Glyma09g06550

Limit To All Plant Sequences

>Glyma09g06550.1   sequence type=predicted peptide   gene model=Glyma09g06550   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVNRISNYVPLFIILIVLVTVQKQVEGLTCSRYFGLCSDTRNCDLRCKARNKHAEGHCDDDFNCTCIYPCDSPQPNKDTEPIRKCTSGLGLCSVDHCYDDCCNSKCAKQFKEGIGHCEIVGSMGTILCTCDYVC*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain