Glyma09g06025 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g06025

Feature Type:	gene_model
Chromosome:	Gm09
Start:	4792984
stop:	4793445
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g06025

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G35810	AT	Annotation by Michelle Graham. TAIR10: Ankyrin repeat family protein \| chr5:13993428-13994549 REVERSE LENGTH=347	SoyBase	E_val: 5.00E-18	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
UniRef100_B9RI93	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Ankyrin repeat-containing protein, putative n=1 Tax=Ricinus communis RepID=B9RI93_RICCO	SoyBase	E_val: 1.00E-15	ISS
UniRef100_I1L190	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1L190_SOYBN	SoyBase	E_val: 3.00E-91	ISS

Expression Patterns of Glyma09g06025

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g06025 not represented in the dataset	Glyma09g06025 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g06025 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.09g054500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma09g06025

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g06025

Limit To All Plant Sequences

>Glyma09g06025.1   sequence type=CDS   gene model=Glyma09g06025   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTTGTTTCTACACTCATAACCGCAGGAGTTTTCATTGCAACCTTTTGCCCAAACTCCAGCATTCCTAGCATCCATAAAAAAACACAAACTCCCAACTTTTTGCACAAACCAGCATTCCTAGCATTTTCATTAGCAGTAACATTTGCACTGATATCAGCATCAGCATCCATACTGATGTTCCTGTCTATACTAATTTCAAGCTATGCAGAGGAAGAATGTTTCAAGTTGCTCCCTAAAAGGTTACTAATTGGAATGGTGGCACAAATTATCTCCATCACAAACATGATGGTAGCTTTCAGTGCTGCATTTTGCATGTCATATTCCCATGGTTCAAAGTGGGTTCAAATTTTCATATTTGTCATTTCAATTGTGCCCTTATTCTTGTTGTTTCCACTTTGTTGGTTTGATATTATCCGCTCATCTTACTTTTGCATGCCTCTATTTCGAAGGAGAAAGTAA

Predicted protein sequences of Glyma09g06025

Limit To All Plant Sequences

>Glyma09g06025.1   sequence type=predicted peptide   gene model=Glyma09g06025   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLVSTLITAGVFIATFCPNSSIPSIHKKTQTPNFLHKPAFLAFSLAVTFALISASASILMFLSILISSYAEEECFKLLPKRLLIGMVAQIISITNMMVAFSAAFCMSYSHGSKWVQIFIFVISIVPLFLLFPLCWFDIIRSSYFCMPLFRRRK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain