Glyma09g05720 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g05720

Feature Type:	gene_model
Chromosome:	Gm09
Start:	4493990
stop:	4495070
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g05720

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G15000	AT	Annotation by Michelle Graham. TAIR10: Ribosomal L27e protein family \| chr4:8571896-8572303 FORWARD LENGTH=135	SoyBase	E_val: 5.00E-78	ISS
GO:0001510	GO-bp	Annotation by Michelle Graham. GO Biological Process: RNA methylation	SoyBase	N/A	ISS
GO:0006412	GO-bp	Annotation by Michelle Graham. GO Biological Process: translation	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005840	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: ribosome	SoyBase	N/A	ISS
GO:0022625	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit	SoyBase	N/A	ISS
GO:0022626	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome	SoyBase	N/A	ISS
GO:0003735	GO-mf	Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome	SoyBase	N/A	ISS
KOG3418	KOG	60S ribosomal protein L27	JGI		ISS
PTHR10497	Panther	60S RIBOSOMAL PROTEIN L27E	JGI		ISS
PF00467	PFAM	KOW motif	JGI		ISS
PF01777	PFAM	Ribosomal L27e protein family	JGI		ISS
UniRef100_I1MGV6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L27 n=3 Tax=Magnoliophyta RepID=I1MGV6_SOYBN	SoyBase	E_val: 2.00E-91	ISS
UniRef100_I1MGV6	UniRef	Annotation by Michelle Graham. Best UniRef hit: 60S ribosomal protein L27 n=3 Tax=Magnoliophyta RepID=I1MGV6_SOYBN	SoyBase	E_val: 2.00E-91	ISS

Expression Patterns of Glyma09g05720

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma09g05720

Paralog	Evidence	Comments
Glyma15g17010	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma09g05720 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.09g052100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma09g05720

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g05720

Limit To All Plant Sequences

>Glyma09g05720.2   sequence type=CDS   gene model=Glyma09g05720   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTCGAAAGGAGAAGGAGAATATGAGCAAGGGTCGCCCAAGGAGAAGGAGAAGGAGAAGGAGAAGGAAATGGAAAATGGAAGTTTGGGGCTTCAGGTCAGAGAGAGTGAGAGACGGCAAAGACGGAGGAGAGGTCGCAAACGCAAAAATGGTGAAGTTTCTGAAACCAAACAAGGCCGTCATTGTCCTTCAGGGACGCTACGCCGGCAAGAAAGCCGTGATCGTTCGAACCTTCGACGAAGGAACTCGCGAGCGCCCCTACGGCCACTGTTTGGTGGCGGGGATAAAGAAGTACCCTGCGAAGGTGATCAAGAAGGACTCGGCGAAGAAGACGGCGAAGAAGTCGCGCGTGAAGGCGTTCGTGAAGCTCGTCAACTACCAGCACCTCATGCCCACGCGCTACACGCTTGACGTGGACTTGAAGGACGCGGTTAACCCCGACGTTCTCAACGCGAAGGATAAGAAGGTCACTGCTCTCAAGGAGACCAAGAAGCGCCTCGAGGAGAGGTTCAAAACCGGGAAGAACCGGTGGTTCTTCACCAAGCTCAGGTTCTGA

Predicted protein sequences of Glyma09g05720

Limit To All Plant Sequences

>Glyma09g05720.2   sequence type=predicted peptide   gene model=Glyma09g05720   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGRKEKENMSKGRPRRRRRRRRRKWKMEVWGFRSERVRDGKDGGEVANAKMVKFLKPNKAVIVLQGRYAGKKAVIVRTFDEGTRERPYGHCLVAGIKKYPAKVIKKDSAKKTAKKSRVKAFVKLVNYQHLMPTRYTLDVDLKDAVNPDVLNAKDKKVTALKETKKRLEERFKTGKNRWFFTKLRF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain