SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g05230): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g05230): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g05230

Feature Type:gene_model
Chromosome:Gm09
Start:4031785
stop:4033463
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G20260AT Annotation by Michelle Graham. TAIR10: plasma-membrane associated cation-binding protein 1 | chr4:10941593-10943227 FORWARD LENGTH=166 SoyBaseE_val: 2.00E-53ISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0006816GO-bp Annotation by Michelle Graham. GO Biological Process: calcium ion transport SoyBaseN/AISS
GO:0006970GO-bp Annotation by Michelle Graham. GO Biological Process: response to osmotic stress SoyBaseN/AISS
GO:0007030GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi organization SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0010350GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to magnesium starvation SoyBaseN/AISS
GO:0018008GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal peptidyl-glycine N-myristoylation SoyBaseN/AISS
GO:0031115GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of microtubule polymerization SoyBaseN/AISS
GO:0031117GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of microtubule depolymerization SoyBaseN/AISS
GO:0035865GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to potassium ion SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0043622GO-bp Annotation by Michelle Graham. GO Biological Process: cortical microtubule organization SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0048767GO-bp Annotation by Michelle Graham. GO Biological Process: root hair elongation SoyBaseN/AISS
GO:0051511GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of unidimensional cell growth SoyBaseN/AISS
GO:0051592GO-bp Annotation by Michelle Graham. GO Biological Process: response to calcium ion SoyBaseN/AISS
GO:0071219GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to molecule of bacterial origin SoyBaseN/AISS
GO:0071280GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to copper ion SoyBaseN/AISS
GO:0071281GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to iron ion SoyBaseN/AISS
GO:0071286GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to magnesium ion SoyBaseN/AISS
GO:0071325GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to mannitol stimulus SoyBaseN/AISS
GO:0071472GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to salt stress SoyBaseN/AISS
GO:0072709GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to sorbitol SoyBaseN/AISS
GO:0075733GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular transport of viral material SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005881GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasmic microtubule SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0046658GO-cc Annotation by Michelle Graham. GO Cellular Compartment: anchored to plasma membrane SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
GO:0005509GO-mf Annotation by Michelle Graham. GO Molecular Function: calcium ion binding SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0005516GO-mf Annotation by Michelle Graham. GO Molecular Function: calmodulin binding SoyBaseN/AISS
GO:0005546GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphatidylinositol-4,5-bisphosphate binding SoyBaseN/AISS
GO:0005547GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphatidylinositol-3,4,5-trisphosphate binding SoyBaseN/AISS
GO:0008017GO-mf Annotation by Michelle Graham. GO Molecular Function: microtubule binding SoyBaseN/AISS
GO:0043325GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphatidylinositol-3,4-bisphosphate binding SoyBaseN/AISS
GO:0080025GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphatidylinositol-3,5-bisphosphate binding SoyBaseN/AISS
PTHR22683Panther SPORULATION PROTEIN RELATED JGI ISS
PTHR22683:SF34Panther SUBFAMILY NOT NAMED JGI ISS
PF05558PFAM DREPP plasma membrane polypeptide JGI ISS
UniRef100_C6SXW7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SXW7_SOYBN SoyBaseE_val: 1.00E-132ISS
UniRef100_Q9SMK5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Plasma membrane intrinsic polypeptide n=1 Tax=Cicer arietinum RepID=Q9SMK5_CICAR SoyBaseE_val: 5.00E-63ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g05230 not represented in the dataset

Glyma09g05230 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma15g16560 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g047200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma09g05230.1   sequence type=CDS   gene model=Glyma09g05230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTTATTGGAAGTCTAAGGTTCTTCCCAAGATCAAGAAGGTTTTCGAGAAGAATAGCACCAAGAAAGCTGCTGCTGCTGAGGCCACCAAGTCCTTTGATGAGTCAAAGGAGGAATACAACAAAGCCTTTGAAGAAAAGAAGACTGAACTTCAAACCAAAGTTGTTGAAATATATGAGGCTTCATCAACTGAAATCAAGAGTTTGGTTAAAGAACCCAAGGAAGCTGGTTTGAAGAAGAACTCCACAGAAGTCCAGAAGTTCCTAGAAGAGCTGGTTAAAATTGATTTCCCTGGATCAAAGGCGGCATCTGAAGCATCTTCAAAGTTTGGACCAGCCTTGGCTTCAGGTTCAGTTTTCTTTGTGTTTGAGAAGGTGTCCACTTTCATTGTTACAGAAGAAAAAGAAGTTGAAGCCCCTCCTGCAGTAGAAACTAAAACAGAAGAAGAAACAAGTAGTGTTGTCAAAGAGAGGGAGACAGTGGTTGAAGAAGAAAAAAAGGAAGAGGAAAAACCACAAGCAGACGAGACAAGTGATGAGAAAAAAGTGGAAGAAAAACAAGCTGAGACTGCTGCTAAAGAGGAAGAGAAACCTGCTGAACCAGCAGAACCACCAAAGCCTTGA

>Glyma09g05230.1   sequence type=predicted peptide   gene model=Glyma09g05230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGYWKSKVLPKIKKVFEKNSTKKAAAAEATKSFDESKEEYNKAFEEKKTELQTKVVEIYEASSTEIKSLVKEPKEAGLKKNSTEVQKFLEELVKIDFPGSKAASEASSKFGPALASGSVFFVFEKVSTFIVTEEKEVEAPPAVETKTEEETSSVVKERETVVEEEKKEEEKPQADETSDEKKVEEKQAETAAKEEEKPAEPAEPPKP*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo