SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g05060

Feature Type:gene_model
Chromosome:Gm09
Start:3835105
stop:3839169
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g05060
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G15790AT Annotation by Michelle Graham. TAIR10: unknown protein; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast; EXPRESSED IN: 21 plant structures; EXPRESSED DURING: 13 growth stages; Has 411 Blast hits to 380 proteins in 121 species: Archae - 4; Bacteria - 107; Metazoa - 85; Fungi - 29; Plants - 59; Viruses - 0; Other Eukaryotes - 127 (source: NCBI BLink). | chr4:8982390-8984069 FORWARD LENGTH=147 SoyBaseE_val: 1.00E-45ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
UniRef100_C6SXZ5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SXZ5_SOYBN SoyBaseE_val: 2.00E-94ISS

Expression Patterns of Glyma09g05060
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma09g05060
ParalogEvidenceComments
Glyma15g15770 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma09g05060 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g045300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma09g05060
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g05060
>Glyma09g05060.1   sequence type=CDS   gene model=Glyma09g05060   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCAACCCTGATTCCTCTCTTCCTCTCTCCATCAAGAAGGAGAACATCACTCCCATTACCTCTAAAATCGAGGAACTTAATGAATCGAGATCGGAGCTTCTGGGCAGAGTTCAGAGTTTGAAACAGGATTTGCAAAGTTGGAGGTCTAAGTTGGATACACAAGTCAAGGTCTATCGCGATGAGCTGTCAGAACTTAAGAAAACACTTAATGTTGAAGTGGACCAACTCAGAGCAGAATTTCAAGATCTGAGGACTACCCTGCAGCAGCAACAAGAAGATGTTACTGCTAGCTTAAGAAACCTGGGGCTTCAAGATGTCTCAGATGTCAAGCATGCTCCATCGCAGGAAACAAAGATTGAAGAAATTGTGAAGGAAGAACAGGTGGTGGTACCTGAAGAAGATAATAGCAGCAAAGTAACTGAAAATTAA
Predicted protein sequences of Glyma09g05060
>Glyma09g05060.1   sequence type=predicted peptide   gene model=Glyma09g05060   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MANPDSSLPLSIKKENITPITSKIEELNESRSELLGRVQSLKQDLQSWRSKLDTQVKVYRDELSELKKTLNVEVDQLRAEFQDLRTTLQQQQEDVTASLRNLGLQDVSDVKHAPSQETKIEEIVKEEQVVVPEEDNSSKVTEN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo