SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g04950

Feature Type:gene_model
Chromosome:Gm09
Start:3728772
stop:3732572
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g04950
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G16640AT Annotation by Michelle Graham. TAIR10: translationally controlled tumor protein | chr3:5669709-5670729 REVERSE LENGTH=168 SoyBaseE_val: 3.00E-91ISS
GO:0001558GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell growth SoyBaseN/AISS
GO:0007346GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of mitotic cell cycle SoyBaseN/AISS
GO:0008283GO-bp Annotation by Michelle Graham. GO Biological Process: cell proliferation SoyBaseN/AISS
GO:0009734GO-bp Annotation by Michelle Graham. GO Biological Process: auxin mediated signaling pathway SoyBaseN/AISS
GO:0009790GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development SoyBaseN/AISS
GO:0009791GO-bp Annotation by Michelle Graham. GO Biological Process: post-embryonic development SoyBaseN/AISS
GO:0009819GO-bp Annotation by Michelle Graham. GO Biological Process: drought recovery SoyBaseN/AISS
GO:0009860GO-bp Annotation by Michelle Graham. GO Biological Process: pollen tube growth SoyBaseN/AISS
GO:0010252GO-bp Annotation by Michelle Graham. GO Biological Process: auxin homeostasis SoyBaseN/AISS
GO:0031117GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of microtubule depolymerization SoyBaseN/AISS
GO:0040014GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of multicellular organism growth SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0048364GO-bp Annotation by Michelle Graham. GO Biological Process: root development SoyBaseN/AISS
GO:0048527GO-bp Annotation by Michelle Graham. GO Biological Process: lateral root development SoyBaseN/AISS
GO:0048768GO-bp Annotation by Michelle Graham. GO Biological Process: root hair cell tip growth SoyBaseN/AISS
GO:0090333GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of stomatal closure SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0090406GO-cc Annotation by Michelle Graham. GO Cellular Compartment: pollen tube SoyBaseN/AISS
GO:0008017GO-mf Annotation by Michelle Graham. GO Molecular Function: microtubule binding SoyBaseN/AISS
KOG1727 KOG Microtubule-binding protein (translationally controlled tumor protein) JGI ISS
PTHR11991Panther TRANSLATIONALLY CONTROLLED TUMOR PROTEIN-RELATED JGI ISS
PF00838PFAM Translationally controlled tumour protein JGI ISS
UniRef100_Q944T2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Translationally-controlled tumor protein homolog n=2 Tax=Glycine max RepID=TCTP_SOYBN SoyBaseE_val: 2.00E-117ISS
UniRef100_Q944T2UniRef Annotation by Michelle Graham. Best UniRef hit: Translationally-controlled tumor protein homolog n=2 Tax=Glycine max RepID=TCTP_SOYBN SoyBaseE_val: 2.00E-117ISS

Expression Patterns of Glyma09g04950
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma09g04950
ParalogEvidenceComments
Glyma15g15910 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma09g04950 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g044200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma09g04950
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g04950
>Glyma09g04950.1   sequence type=CDS   gene model=Glyma09g04950   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTGGTTTACCAGGACCTCCTTACAGGTGATGAGCTTCTCTCTGACTCCTTCCGTTACAAGGAAATTGAGAATGGAATGCTGTGGGAAGTTGAGGGGAAGTGGGTTGTTAAAGGAGCAGTTGATGTAGACATTGGTGCAAACCCTTCTGCTGAGGGTGGAGGAGAAGATGAGGGAGTTGATGATGCAGCTGTTAAGGTTGTTGACATTGTTGACACATTCAGACTTCAGGAGCAACCCGCATTCGATAAGAAGCAGTTTGTTACCTTCATGAAGAGGTTTATCAAGAATTTGACTCCCAAGCTCGATGCAGAGCAACAGGAGTTGTTTAAGAAGCACATCGAGGGAGCAACTAAATACCTGCTCTCTAAGATTAAAGATTTCCAATTTTTTGTTGGTGAGAGCATGGGTGATGATGCTTGCTTGGTCTTTGCCTACTACAAGGACGGCGCTGCTGATCCAACATTCCTGTACTTTGCATATGCCTTAAAGGAGGTCAAGTGCTAA
Predicted protein sequences of Glyma09g04950
>Glyma09g04950.1   sequence type=predicted peptide   gene model=Glyma09g04950   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLVYQDLLTGDELLSDSFRYKEIENGMLWEVEGKWVVKGAVDVDIGANPSAEGGGEDEGVDDAAVKVVDIVDTFRLQEQPAFDKKQFVTFMKRFIKNLTPKLDAEQQELFKKHIEGATKYLLSKIKDFQFFVGESMGDDACLVFAYYKDGAADPTFLYFAYALKEVKC*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo