Glyma09g04480 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g04480

Feature Type:	gene_model
Chromosome:	Gm09
Start:	3305770
stop:	3308895
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g04480

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
ATMG00160	AT	Annotation by Michelle Graham. TAIR10: cytochrome oxidase 2 \| chrM:40502-42628 REVERSE LENGTH=260	SoyBase	E_val: 3.00E-151	ISS
GO:0022900	GO-bp	Annotation by Michelle Graham. GO Biological Process: electron transport chain	SoyBase	N/A	ISS
GO:0022904	GO-bp	Annotation by Michelle Graham. GO Biological Process: respiratory electron transport chain	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005751	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial respiratory chain complex IV	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0016021	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane	SoyBase	N/A	ISS
GO:0004129	GO-mf	Annotation by Michelle Graham. GO Molecular Function: cytochrome-c oxidase activity	SoyBase	N/A	ISS
GO:0005507	GO-mf	Annotation by Michelle Graham. GO Molecular Function: copper ion binding	SoyBase	N/A	ISS
GO:0009055	GO-mf	Annotation by Michelle Graham. GO Molecular Function: electron carrier activity	SoyBase	N/A	ISS
GO:0016491	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity	SoyBase	N/A	ISS
GO:0020037	GO-mf	Annotation by Michelle Graham. GO Molecular Function: heme binding	SoyBase	N/A	ISS
KOG4767	KOG	Cytochrome c oxidase, subunit II, and related proteins	JGI		ISS
PTHR22888	Panther	CYTOCHROME C OXIDASE, SUBUNIT II	JGI		ISS
PF00116	PFAM	Cytochrome C oxidase subunit II, periplasmic domain	JGI		ISS
PF02790	PFAM	Cytochrome C oxidase subunit II, transmembrane domain	JGI		ISS
UniRef100_Q02226	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Cytochrome c oxidase subunit 2, mitochondrial (Fragment) n=2 Tax=Glycine max RepID=COXT_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_Q02226	UniRef	Annotation by Michelle Graham. Best UniRef hit: Cytochrome c oxidase subunit 2, mitochondrial (Fragment) n=2 Tax=Glycine max RepID=COXT_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma09g04480

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma09g04480

Paralog	Evidence	Comments
Glyma15g15530	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma09g04480 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.09g040100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma09g04480

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g04480

Limit To All Plant Sequences

>Glyma09g04480.1   sequence type=CDS   gene model=Glyma09g04480   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGCCTGCTATCTTGTTTTAGGTCTACCGTCCTGAGAAAATGTTCCAAAGGAAGCTCTGGCATGTCAAGATTCCTGTATACGAACAATTTTCAACGAAACTTGATTTCGTCTGGTGGCAATGAATCGTATTATGGGTATTTTAACAGGAGATCATACACTTCACTTTATATGGGAACTGGAACTGTGGGTGGGATTACAAGTGCTAGAATCAGGGTGCCAAATGTAGGATGTGAAGGATTCATGTGCTCAAGTCATCTGTCAATCACTCAAAGAAATTCAAGATTGATCCATTCTACTAGCAAGATTGTTCCAAATTCTGAAATTCAGAATATAACTACTGAGATGGTGAAGACACCAGAGGTCTCAAGATGGATGGATCAAGTCATCCCTACAATAGCCCCTTGTGATGCAGCAGAACCATGGCAACTAGGGTTTCAAGATGCAGCAACACCTATAATGCAAGGAATAATAGACTTACATCACGATATCTTTTTCTTCGTCATTCAGATTGGAGTTTTTGTATCATGGGTCTTGCTTCGTGCTTTATGGCATTTCAGGTCTAAAATGAATCCAATCCCTCAAAGAATTGTTCATGGAACAACAATCGAGATTCTTTGGACCATATTTCCTAGTGTCATACTAATGTTCATTGCTATACCATCGTTTGCTTTGTTATACTCAATGGATGATATTGTAGTGGATCCAGCCATTACTATCAAAGCTATTGGACATCAATGGTATTGGACTTATGAGTATTCAGACTATAACAACTCTGATGAACAATCACTTGCTTTTGATAGTTATATGATTCCAGAAGATGATCTAGAATTAGGGCAATTACGTTTACTAGAAGTGGACAATAGAGTGGTAGTGCCAGCTAAAACTCATCTGCGTGTTATTATAACATCAGCTGATGTACTTCATAGTTGGGCAGTACCTTCCCTGGGTGTCAAATGTGATGCTGTGCCTGGTCGTTTGAATCAGATCTCTACTTTTATACAAAGAGAAGGGGTTTACTATGGTCAATGCAGTGAGATTTGTGGAACTAACCATGCCTTTATGCCTATTGTCATAGAAGCAGTTTCTACTAAAGATTATGGTTCTTGGGTTTCCAGTCAAGTCAACTAA

Predicted protein sequences of Glyma09g04480

Limit To All Plant Sequences

>Glyma09g04480.1   sequence type=predicted peptide   gene model=Glyma09g04480   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGLLSCFRSTVLRKCSKGSSGMSRFLYTNNFQRNLISSGGNESYYGYFNRRSYTSLYMGTGTVGGITSARIRVPNVGCEGFMCSSHLSITQRNSRLIHSTSKIVPNSEIQNITTEMVKTPEVSRWMDQVIPTIAPCDAAEPWQLGFQDAATPIMQGIIDLHHDIFFFVIQIGVFVSWVLLRALWHFRSKMNPIPQRIVHGTTIEILWTIFPSVILMFIAIPSFALLYSMDDIVVDPAITIKAIGHQWYWTYEYSDYNNSDEQSLAFDSYMIPEDDLELGQLRLLEVDNRVVVPAKTHLRVIITSADVLHSWAVPSLGVKCDAVPGRLNQISTFIQREGVYYGQCSEICGTNHAFMPIVIEAVSTKDYGSWVSSQVN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain