SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g04352

Feature Type:gene_model
Chromosome:Gm09
Start:3203690
stop:3206600
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g04352
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G16146AT Annotation by Michelle Graham. TAIR10: cAMP-regulated phosphoprotein 19-related protein | chr4:9142663-9144356 REVERSE LENGTH=102 SoyBaseE_val: 1.00E-31ISS
GO:0007623GO-bp Annotation by Michelle Graham. GO Biological Process: circadian rhythm SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF04667PFAM cAMP-regulated phosphoprotein/endosulfine conserved region JGI ISS
UniRef100_B6T0Q4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Negatively light-regulated protein n=1 Tax=Zea mays RepID=B6T0Q4_MAIZE SoyBaseE_val: 2.00E-20ISS
UniRef100_G7IMV3UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Medicago truncatula RepID=G7IMV3_MEDTR SoyBaseE_val: 3.00E-61ISS

Expression Patterns of Glyma09g04352
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g04352 not represented in the dataset
Glyma09g04352 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma09g04352
ParalogEvidenceComments
Glyma15g15380 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma09g04352 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g038700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma09g04352
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g04352
>Glyma09g04352.1   sequence type=CDS   gene model=Glyma09g04352   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GATGCATATTCTTATCCAACCTTCTCACTCAAACCTCTTCTATCTCATTGTCTCTACCTCTCTTTTCTCCCCTTTAATACCTTTTTCTCTCACTTTCTCTTCCTTGCATCTCTACCTTCCTCTTACCACAAGATGGCAGGGTATGATAAGGAAGACTATTTCTCTGCCCCGAATGCCGAGACAACATGCGCGGGAAAGTACGGTAGGCTTGCCCCAAAGAAGAAGCCTCTGATATCGAAAAATAATGAAAGAGCATTCTTTGATTCAGCAGACTGGGCATTATGCAAGCAAGGTGCTGGAGTGAATCAACAATCTACAACAGCTGTGGAGACATTGCGACCAAAACTACAGAGAACTCCACATCAGCAGCTTCCTCCAAGACGACCTGCATGCACATCTGGGAGAGTAGACTTAATAAGTGGAACAAGGATTTGCTCAGTCAATTTTACTATTACAAAACTCATGATGTTCCTGATCTGA
Predicted protein sequences of Glyma09g04352
>Glyma09g04352.1   sequence type=predicted peptide   gene model=Glyma09g04352   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
DAYSYPTFSLKPLLSHCLYLSFLPFNTFFSHFLFLASLPSSYHKMAGYDKEDYFSAPNAETTCAGKYGRLAPKKKPLISKNNERAFFDSADWALCKQGAGVNQQSTTAVETLRPKLQRTPHQQLPPRRPACTSGRVDLISGTRICSVNFTITKLMMFLI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo