Report for Sequence Feature Glyma09g04352
Feature Type: gene_model
Chromosome: Gm09
Start: 3203690
stop: 3206600
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma09g04352
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G16146 AT
Annotation by Michelle Graham. TAIR10: cAMP-regulated phosphoprotein 19-related protein | chr4:9142663-9144356 REVERSE LENGTH=102
SoyBase E_val: 1.00E-31 ISS
GO:0007623 GO-bp
Annotation by Michelle Graham. GO Biological Process: circadian rhythm
SoyBase N/A ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
PF04667 PFAM
cAMP-regulated phosphoprotein/endosulfine conserved region
JGI ISS
UniRef100_B6T0Q4 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Negatively light-regulated protein n=1 Tax=Zea mays RepID=B6T0Q4_MAIZE
SoyBase E_val: 2.00E-20 ISS
UniRef100_G7IMV3 UniRef
Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Medicago truncatula RepID=G7IMV3_MEDTR
SoyBase E_val: 3.00E-61 ISS
Expression Patterns of Glyma09g04352
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma09g04352
Paralog Evidence Comments
Glyma15g15380 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma09g04352 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.09g038700 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma09g04352
Coding sequences of Glyma09g04352
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma09g04352.1 sequence type=CDS gene model=Glyma09g04352 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
GATGCATATTCTTATCCAACCTTCTCACTCAAACCTCTTCTATCTCATTGTCTCTACCTCTCTTTTCTCCCCTTTAATACCTTTTTCTCTCACTTTCTCTTCCTTGCATCTCTACCTTCCTCTTACCACAAGATGGCAGGGTATGATAAGGAAGACTATTTCTCTGCCCCGAATGCCGAGACAACATGCGCGGGAAAGTACGGTAGGCTTGCCCCAAAGAAGAAGCCTCTGATATCGAAAAATAATGAAAGAGCATTCTTTGATTCAGCAGACTGGGCATTATGCAAGCAAGGTGCTGGAGTGAATCAACAATCTACAACAGCTGTGGAGACATTGCGACCAAAACTACAGAGAACTCCACATCAGCAGCTTCCTCCAAGACGACCTGCATGCACATCTGGGAGAGTAGACTTAATAAGTGGAACAAGGATTTGCTCAGTCAATTTTACTATTACAAAACTCATGATGTTCCTGATCTGA
Predicted protein sequences of Glyma09g04352
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma09g04352.1 sequence type=predicted peptide gene model=Glyma09g04352 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
DAYSYPTFSLKPLLSHCLYLSFLPFNTFFSHFLFLASLPSSYHKMAGYDKEDYFSAPNAETTCAGKYGRLAPKKKPLISKNNERAFFDSADWALCKQGAGVNQQSTTAVETLRPKLQRTPHQQLPPRRPACTSGRVDLISGTRICSVNFTITKLMMFLI*