SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g03511): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g03511): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g03511

Feature Type:gene_model
Chromosome:Gm09
Start:2500888
stop:2504220
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G44520AT Annotation by Michelle Graham. TAIR10: NagB/RpiA/CoA transferase-like superfamily protein | chr5:17934610-17936441 REVERSE LENGTH=296 SoyBaseE_val: 5.00E-39ISS
GO:0006015GO-bp Annotation by Michelle Graham. GO Biological Process: 5-phosphoribose 1-diphosphate biosynthetic process SoyBaseN/AISS
GO:0006098GO-bp Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt SoyBaseN/AISS
GO:0009052GO-bp Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt, non-oxidative branch SoyBaseN/AISS
GO:0016556GO-bp Annotation by Michelle Graham. GO Biological Process: mRNA modification SoyBaseN/AISS
GO:0019253GO-bp Annotation by Michelle Graham. GO Biological Process: reductive pentose-phosphate cycle SoyBaseN/AISS
GO:0019303GO-bp Annotation by Michelle Graham. GO Biological Process: D-ribose catabolic process SoyBaseN/AISS
GO:0019658GO-bp Annotation by Michelle Graham. GO Biological Process: glucose catabolic process to lactate and acetate SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0004751GO-mf Annotation by Michelle Graham. GO Molecular Function: ribose-5-phosphate isomerase activity SoyBaseN/AISS
PTHR11934Panther RIBOSE-5-PHOSPHATE ISOMERASE JGI ISS
PF06026PFAM Ribose 5-phosphate isomerase A (phosphoriboisomerase A) JGI ISS
UniRef100_G7IMN1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ribose-5-phosphate isomerase A n=2 Tax=Medicago truncatula RepID=G7IMN1_MEDTR SoyBaseE_val: 2.00E-51ISS
UniRef100_UPI0002338029UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002338029 related cluster n=1 Tax=unknown RepID=UPI0002338029 SoyBaseE_val: 3.00E-53ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g03511 not represented in the dataset

Glyma09g03511 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma15g14460 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g030500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma09g03511.1   sequence type=CDS   gene model=Glyma09g03511   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACAATTGCTGAAGAGATTGATGATATGTTTCTGGGTGATGCTGAGGTCTGGAGAAGACCATCTATAGGGCAAGCAGGTCCACTAGGAGGTGACTTCCCAGTAGTCACCAGCGAAGGACATAATATTCCTGATGTTATCTTTACATCTCCAATAGAAAACCTTGCTGAAGTAGCAAAATGCCTTGATAAAGTTGATGGTGTTGTGGACCATGGTGTCGTATCTAAAGTCCCATGCACAGTTGTAATTGCTTCTCAGACTGGACTGAAAATTTTGGACAAACTAACTGCAGATATAGTGGGTTAG

>Glyma09g03511.1   sequence type=predicted peptide   gene model=Glyma09g03511   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTIAEEIDDMFLGDAEVWRRPSIGQAGPLGGDFPVVTSEGHNIPDVIFTSPIENLAEVAKCLDKVDGVVDHGVVSKVPCTVVIASQTGLKILDKLTADIVG*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo