Glyma09g02821 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g02821): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g02821): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g02821

Feature Type:	gene_model
Chromosome:	Gm09
Start:	1940819
stop:	1941159
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g02821

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G64760	AT	Annotation by Michelle Graham. TAIR10: O-Glycosyl hydrolases family 17 protein \| chr1:24054220-24056194 REVERSE LENGTH=481	SoyBase	E_val: 3.00E-34	ISS
GO:0005975	GO-bp	Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0031225	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane	SoyBase	N/A	ISS
GO:0046658	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: anchored to plasma membrane	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0004553	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds	SoyBase	N/A	ISS
GO:0043169	GO-mf	Annotation by Michelle Graham. GO Molecular Function: cation binding	SoyBase	N/A	ISS
PF00332	PFAM	Glycosyl hydrolases family 17	JGI		ISS
UniRef100_A2Q5Q4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Glucan endo-1,3-beta-glucosidase n=1 Tax=Medicago truncatula RepID=A2Q5Q4_MEDTR	SoyBase	E_val: 1.00E-41	ISS
UniRef100_I1ML36	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1ML36_SOYBN	SoyBase	E_val: 2.00E-57	ISS

Expression Patterns of Glyma09g02821

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g02821 not represented in the dataset	Glyma09g02821 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g02821 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.09g024300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma09g02821

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g02821

Limit To All Plant Sequences

>Glyma09g02821.1   sequence type=CDS   gene model=Glyma09g02821   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGAAAAACTGGGTTTTGAGATGGAGTTTTGTGGTGGGGTTGATGTGTTTGAGCGTGGAAGGGATTGGTATGAATTGGGGAACTCAAGCAACCCACAAGTGGCCACAACACACAGTGGTTCAGATGTTGAAGGATAATGGGATTAAGAAAGTGAAGCTTTTTGATTCAGATGACTCCACCATGAGTGCTTTGGCTGGGACTGGGATTGAACTTGCCGAGATGAATGACTATGCCAGGGCCAAACAATGGGTCAAGAAAAATGTCACACGTTACAACTTCAATGGAGGAGTTAATGTCAAGTGA

Predicted protein sequences of Glyma09g02821

Limit To All Plant Sequences

>Glyma09g02821.1   sequence type=predicted peptide   gene model=Glyma09g02821   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEKNWVLRWSFVVGLMCLSVEGIGMNWGTQATHKWPQHTVVQMLKDNGIKKVKLFDSDDSTMSALAGTGIELAEMNDYARAKQWVKKNVTRYNFNGGVNVK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain