SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma09g01000

Feature Type:gene_model
Chromosome:Gm09
Start:539260
stop:546978
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G62360AT Annotation by Michelle Graham. TAIR10: KNOX/ELK homeobox transcription factor | chr1:23058796-23061722 REVERSE LENGTH=382 SoyBaseE_val: 2.00E-132ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0007389GO-bp Annotation by Michelle Graham. GO Biological Process: pattern specification process SoyBaseN/AISS
GO:0009691GO-bp Annotation by Michelle Graham. GO Biological Process: cytokinin biosynthetic process SoyBaseN/AISS
GO:0009855GO-bp Annotation by Michelle Graham. GO Biological Process: determination of bilateral symmetry SoyBaseN/AISS
GO:0009886GO-bp Annotation by Michelle Graham. GO Biological Process: post-embryonic morphogenesis SoyBaseN/AISS
GO:0009887GO-bp Annotation by Michelle Graham. GO Biological Process: organ morphogenesis SoyBaseN/AISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0009934GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of meristem structural organization SoyBaseN/AISS
GO:0010051GO-bp Annotation by Michelle Graham. GO Biological Process: xylem and phloem pattern formation SoyBaseN/AISS
GO:0010093GO-bp Annotation by Michelle Graham. GO Biological Process: specification of floral organ identity SoyBaseN/AISS
GO:0019827GO-bp Annotation by Michelle Graham. GO Biological Process: stem cell maintenance SoyBaseN/AISS
GO:0048438GO-bp Annotation by Michelle Graham. GO Biological Process: floral whorl development SoyBaseN/AISS
GO:0048439GO-bp Annotation by Michelle Graham. GO Biological Process: flower morphogenesis SoyBaseN/AISS
GO:0048440GO-bp Annotation by Michelle Graham. GO Biological Process: carpel development SoyBaseN/AISS
GO:0048481GO-bp Annotation by Michelle Graham. GO Biological Process: ovule development SoyBaseN/AISS
GO:0048507GO-bp Annotation by Michelle Graham. GO Biological Process: meristem development SoyBaseN/AISS
GO:0048513GO-bp Annotation by Michelle Graham. GO Biological Process: organ development SoyBaseN/AISS
GO:0048519GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
KOG0773 KOG Transcription factor MEIS1 and related HOX domain proteins JGI ISS
PTHR11850Panther HOMEOBOX PROTEIN JGI ISS
PTHR11850:SF48Panther HOMEOBOX PROTEIN MEIS3 JGI ISS
PF00046PFAM Homeobox domain JGI ISS
PF03789PFAM ELK domain JGI ISS
PF03790PFAM KNOX1 domain JGI ISS
PF03791PFAM KNOX2 domain JGI ISS
UniRef100_P46608UniRef Annotation by Michelle Graham. Most informative UniRef hit: Homeobox protein SBH1 n=1 Tax=Glycine max RepID=HSBH1_SOYBN SoyBaseE_val: 0ISS
UniRef100_P46608UniRef Annotation by Michelle Graham. Best UniRef hit: Homeobox protein SBH1 n=1 Tax=Glycine max RepID=HSBH1_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma15g11850 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g007500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma09g01000.2   sequence type=CDS   gene model=Glyma09g01000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGGTGGTAGTAGTAGCTCTAATGGCACTTCTTATCTGTTGGCTTTTGGAGAAAACAACAGTGGTGGGCTATGCCCAATGACGATGATGCCTTTGGTGACTTCCCATCACGCTGGTCATCATCCAATAAATCCTAGTAATAATAATAATGTAAACACAAACTGTCTCTTCATTCCCAACTGCAGTAACAGTACTGGAACTCCTTCTATCATGCTCCACAATAATCACAACAACAACAAAACTGATGATGATGATAACAACAACAACACTGGGTTAGGGTACTATTTCATGGAGAGTGACCACCACCACCATCACCACGGCAACAACAACAACAATGGAAGCTCCTCCTCCTCCTCCTCTTCTGCTGTCAAGGCCAAGATCATGGCTCATCCTCACTATCACCGTCTCTTGGCAGCTTACGTCAATTGTCAGAAGGTTGGGGCCCCGCCTGAAGTGGTGGCAAGGTTAGAAGAAGCATGTGCTTCTGCAGCGACAATGGCTGGTGGTGATGCAGCAGCTGGATCAAGCTGCATAGGTGAAGATCCAGCTTTGGATCAGTTCATGGAGGCTTACTGTGAGATGCTCACAAAGTATGAGCAAGAACTCTCCAAACCCTTAAAGGAAGCCATGCTCTTCCTTCAAAGGATCGAGTGCCAGTTCAAAAATCTTACAATTTCTTCCTCCGACTTTGCTAGCAATGAGGGTGGTGATAGGAATGGATCGTCTGAAGAGGATGTTGATCTACACAACATGATAGATCCCCAGGCAGAGGACAGGGATTTAAAGGGTCAGCTTTTGCGCAAGTATAGCGGATACTTGGGCAGTCTGAAGCAAGAATTCATGAAGAAGAGGAAGAAAGGAAAGCTACCTAAAGAAGCAAGGCAACAATTACTTGAATGGTGGAACAGACATTACAAATGGCCTTACCCATCCGAATCCCAGAAGCTGGCTCTTGCAGAGTCGACAGGTCTGGATCAGAAGCAAATCAACAACTGGTTTATTAATCAAAGGAAACGGCACTGGAAGCCTTCAGAGGACATGCAGTTTGTGGTGATGGATCCAAGCCATCCACACTATTACATGGATAATGTTCTAGGCAATCCATTTCCCATGGATCTTTCCCATCCCATGCTCTAG

>Glyma09g01000.2   sequence type=predicted peptide   gene model=Glyma09g01000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEGGSSSSNGTSYLLAFGENNSGGLCPMTMMPLVTSHHAGHHPINPSNNNNVNTNCLFIPNCSNSTGTPSIMLHNNHNNNKTDDDDNNNNTGLGYYFMESDHHHHHHGNNNNNGSSSSSSSSAVKAKIMAHPHYHRLLAAYVNCQKVGAPPEVVARLEEACASAATMAGGDAAAGSSCIGEDPALDQFMEAYCEMLTKYEQELSKPLKEAMLFLQRIECQFKNLTISSSDFASNEGGDRNGSSEEDVDLHNMIDPQAEDRDLKGQLLRKYSGYLGSLKQEFMKKRKKGKLPKEARQQLLEWWNRHYKWPYPSESQKLALAESTGLDQKQINNWFINQRKRHWKPSEDMQFVVMDPSHPHYYMDNVLGNPFPMDLSHPML*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo