Glyma09g00990 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g00990

Feature Type:	gene_model
Chromosome:	Gm09
Start:	533150
stop:	537003
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g00990

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G14620	AT	Annotation by Michelle Graham. TAIR10: decoy \| chr1:5014948-5016501 REVERSE LENGTH=233	SoyBase	E_val: 5.00E-119	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0009909	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of flower development	SoyBase	N/A	ISS
GO:0034968	GO-bp	Annotation by Michelle Graham. GO Biological Process: histone lysine methylation	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
KOG4548	KOG	Mitochondrial ribosomal protein L17	JGI		ISS
PTHR13124	Panther	39S RIBOSOMAL PROTEIN L46, MITOCHONDRIAL PRECURSOR-RELATED	JGI		ISS
PTHR13124:SF2	Panther	gb def: cg13922 gene product [drosophila melanogaster]	JGI		ISS
PF11788	PFAM	39S mitochondrial ribosomal protein L46	JGI		ISS
UniRef100_G7L791	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 39S ribosomal protein L46 n=1 Tax=Medicago truncatula RepID=G7L791_MEDTR	SoyBase	E_val: 4.00E-151	ISS
UniRef100_I1KZW1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KZW1_SOYBN	SoyBase	E_val: 6.00E-169	ISS

Expression Patterns of Glyma09g00990

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma09g00990

Paralog	Evidence	Comments
Glyma15g11840	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma09g00990 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.09g007400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma09g00990

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g00990

Limit To All Plant Sequences

>Glyma09g00990.1   sequence type=CDS   gene model=Glyma09g00990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGATGTCATTGGTTCGACCTCTCTTGACAAAGCGAGGGTTCAGCACAAGCTCTGAGAACCTTGTTGCTTCTGTGCTCTTTGAGAGACTGCCAGTGGTCATTCCCAAAATTGACCCTGTAGTCTATGCATTTCAAGAATTCTCGTTTCGATGGCGACAACAATATCAACGCAGATATCCTGATGAATTTCTAGACAAATCTGATGCAAGGGGGAAAGGTGATTATCAGATTGACTATGTGCCAGCACCACGAGTCACTGAAGCTGACAAAAACAATGATCGAAGGTCATTACAAAGAGCTCTTGATAGAAGACTATACCTTCTCCTCTATGGTATTGCATATGGTGCTCCAAGCGGGAAGCCTGTGTGGCATTTTCCTGAGAAAGTTTATGAATCCGAGGACAACATGCGCAAGTGTGCAGAGTCTGCATTGAAGTCAGTCTTAGGAGATCTTTCTAATACATATTTTGTTGGAAATGCTCCAATGGCCCATACGGTTGTTCAGCCTACAGAAGACCAGTCTAGATCCACATCTTTTAAGAGATTCTTCTTCAAGTCTCAAGTTATTGCTAAAAACAAATTCAACATTGGAAAATGTGAGGATCATGTCTGGGTGACAAAGGATGAATTGATGGAGTATTTTCCCGAGCAAGCTGAGTTTTTGAACAAGATGATCATTAGCTGA

Predicted protein sequences of Glyma09g00990

Limit To All Plant Sequences

>Glyma09g00990.1   sequence type=predicted peptide   gene model=Glyma09g00990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKMSLVRPLLTKRGFSTSSENLVASVLFERLPVVIPKIDPVVYAFQEFSFRWRQQYQRRYPDEFLDKSDARGKGDYQIDYVPAPRVTEADKNNDRRSLQRALDRRLYLLLYGIAYGAPSGKPVWHFPEKVYESEDNMRKCAESALKSVLGDLSNTYFVGNAPMAHTVVQPTEDQSRSTSFKRFFFKSQVIAKNKFNIGKCEDHVWVTKDELMEYFPEQAEFLNKMIIS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain