SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g00935): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g00935): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g00935

Feature Type:gene_model
Chromosome:Gm09
Start:494690
stop:497127
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G21630AT Annotation by Michelle Graham. TAIR10: chitin elicitor receptor kinase 1 | chr3:7615543-7618530 REVERSE LENGTH=617 SoyBaseE_val: 3.00E-110ISS
GO:0002679GO-bp Annotation by Michelle Graham. GO Biological Process: respiratory burst involved in defense response SoyBaseN/AISS
GO:0002752GO-bp Annotation by Michelle Graham. GO Biological Process: cell surface pattern recognition receptor signaling pathway SoyBaseN/AISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0009627GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance SoyBaseN/AISS
GO:0009697GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process SoyBaseN/AISS
GO:0009817GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus, incompatible interaction SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0030968GO-bp Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response SoyBaseN/AISS
GO:0031347GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of defense response SoyBaseN/AISS
GO:0032491GO-bp Annotation by Michelle Graham. GO Biological Process: detection of molecule of fungal origin SoyBaseN/AISS
GO:0032499GO-bp Annotation by Michelle Graham. GO Biological Process: detection of peptidoglycan SoyBaseN/AISS
GO:0035556GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0043069GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death SoyBaseN/AISS
GO:0045087GO-bp Annotation by Michelle Graham. GO Biological Process: innate immune response SoyBaseN/AISS
GO:0046777GO-bp Annotation by Michelle Graham. GO Biological Process: protein autophosphorylation SoyBaseN/AISS
GO:0071219GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to molecule of bacterial origin SoyBaseN/AISS
GO:0071323GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to chitin SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0004674GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0008061GO-mf Annotation by Michelle Graham. GO Molecular Function: chitin binding SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
GO:0019199GO-mf Annotation by Michelle Graham. GO Molecular Function: transmembrane receptor protein kinase activity SoyBaseN/AISS
GO:0042803GO-mf Annotation by Michelle Graham. GO Molecular Function: protein homodimerization activity SoyBaseN/AISS
GO:2001080GO-mf Annotation by Michelle Graham. GO Molecular Function: chitosan binding SoyBaseN/AISS
KOG2345 KOG Serine/threonine protein kinase/TGF-beta stimulated factor JGI ISS
PTHR24420Panther FAMILY NOT NAMED JGI ISS
PTHR24420:SF421Panther SUBFAMILY NOT NAMED JGI ISS
PF07714PFAM Protein tyrosine kinase JGI ISS
UniRef100_D3KTZ7UniRef Annotation by Michelle Graham. Most informative UniRef hit: LysM type receptor kinase n=1 Tax=Lotus japonicus RepID=D3KTZ7_LOTJA SoyBaseE_val: 2.00E-140ISS
UniRef100_UPI0002337BBFUniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002337BBF related cluster n=1 Tax=unknown RepID=UPI0002337BBF SoyBaseE_val: 1.00E-154ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g00935 not represented in the dataset

Glyma09g00935 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma15g11785 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g006900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma09g00935.1   sequence type=CDS   gene model=Glyma09g00935   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TCACAGAGGTCTAAAACTGATCTGCTACAAGAAACGGAAAGTTCAATTTATTACCTCCACTTGACTTTTTCCTTTTTGCAGAAAGCTGCAATTAAAAAGATGGATATGCAAGCATCAAATGAATTTCTTGCAGAATTGAAGGTTCTGACACACGTCCATCACTTGAACTTGGAGCGGTTAATAAGATATTGTGTTGAGGGCTCCTTATTTTTGGTTTATGAGTACATTGAGAACGGCTATTTAAGTCAACATTTGCGAGGCTCAGGAAGGGATCCGTTAACATGGGCAGCTAGAGTTCAAATTGCTCTTGATGCAGCAAGAGGACTGGAATATATCCATGAGCACACAGTTCCTGTCTACATCCATAGAGATATTAAATCAGCAAACATTTTGATTGACAAAAACTTCCGTGCAAAGGTTGCAGATTTTGGTCTCACAAAATTGACCGAATATGGTAGTTCTTCATTACATACGCGTCTTGTGGGTACATTTGGTTATATGCCTCCAGAATATGCACAATACGGTGATGTGTCCTCCAAAATAGATGTATATGCTTTTGGAGTTGTTCTCTATGAACTCATATCAGGCAAGGAAGCTATTGTCAAGATAAACGAACCTGAAAATGAATCAAAAGGACTAGTCTCCTTGTTTGAAGAAGTTCTTGGTCTGTCAGACCCGAATGAAGATCCTCGTCAACTTGTTGATCCTAGACTTGGTGACAAATTCCCTCTTGACTCGGTATTTAAGGTGTCTCAGCTTGCCAAAGTATACACATGA

>Glyma09g00935.1   sequence type=predicted peptide   gene model=Glyma09g00935   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
SQRSKTDLLQETESSIYYLHLTFSFLQKAAIKKMDMQASNEFLAELKVLTHVHHLNLERLIRYCVEGSLFLVYEYIENGYLSQHLRGSGRDPLTWAARVQIALDAARGLEYIHEHTVPVYIHRDIKSANILIDKNFRAKVADFGLTKLTEYGSSSLHTRLVGTFGYMPPEYAQYGDVSSKIDVYAFGVVLYELISGKEAIVKINEPENESKGLVSLFEEVLGLSDPNEDPRQLVDPRLGDKFPLDSVFKVSQLAKVYT*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo